2W80: Complement factor H

Structure of a complex between Neisseria meningitidis factor H binding protein and CCPs 6-7 of human complement factor H. Determined by X-ray diffraction at 2.35 Å resolution. Released 3 Mar 2009.

Method: X-ray diffraction
Resolution: 2.35 Å
Organisms: HOMO SAPIENS, NEISSERIA MENINGITIDIS
Chains: 8
Atoms: 11,942
Mol. weight: 164.82 kDa
Released: 3 Mar 2009

Explore 2W80 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2W80 contains 52 α-helices and 145 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, E and G: 5 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	325	1	1
β-strand	333-335	3	2
α-helix	338-341	4
α-helix	342-344	3
β-strand	347	1	1
β-strand	352-357	6	2
β-strand	361-362	2	3
β-strand	369-375	7	2
β-strand	378-380	3	2
β-strand	386-387	2	3
β-strand	388-390	3	4
α-helix	391-393	3
β-strand	397	1	5
β-strand	404	1	6
β-strand	405-407	3	4
β-strand	411-413	3	7
β-strand	416	1	5
α-helix	417	1
α-helix	423-425	3
β-strand	428-432	5	7
β-strand	435-437	3	7

Chain B: 5 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	322	1	8
β-strand	325	1	9
β-strand	333-335	3	10
α-helix	338-341	4
α-helix	342-344	3
β-strand	347	1	9
β-strand	352-357	6	10
β-strand	361-362	2	11
β-strand	369-375	7	10
β-strand	378-380	3	10
β-strand	386-387	2	11
β-strand	388-390	3	12
α-helix	391-393	3
β-strand	397	1	13
β-strand	404	1	14
β-strand	405-407	3	12
β-strand	411-413	3	15
β-strand	416	1	13
α-helix	417	1
α-helix	423-425	3
β-strand	428-432	5	15
β-strand	435-437	3	15

Chain C: 7 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	81-86	6
α-helix	94	1
α-helix	96	1
β-strand	98-101	4	16
β-strand	110-115	6	17
β-strand	118-122	5	17
β-strand	126-129	4	16
α-helix	134	1
β-strand	138-149	12	17
β-strand	152-165	14	17
β-strand	169-180	12	17
β-strand	184	1	14
β-strand	188-201	14	17
β-strand	203	1	18
α-helix	204	1
β-strand	205	1	19
α-helix	206-208	3
β-strand	214-223	10	18
β-strand	226-236	11	18
β-strand	241-247	7	18
α-helix	252-254	3
β-strand	257-265	9	18
β-strand	270	1	19
β-strand	271-279	9	18
β-strand	282-292	11	18
β-strand	298-307	10	18
β-strand	310-319	10	18

Chain D: 10 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	81-86	6
α-helix	94	1
α-helix	96	1
β-strand	98-100	3	20
β-strand	109-115	7	21
β-strand	118-122	5	21
α-helix	126	1
β-strand	127-129	3	20
α-helix	130-132	3
α-helix	134	1
β-strand	138-148	11	21
β-strand	153-165	13	21
β-strand	169-180	12	21
β-strand	184	1	6
β-strand	188-201	14	21
β-strand	203	1	22
α-helix	204	1
β-strand	205	1	23
α-helix	206-208	3
β-strand	214-223	10	22
β-strand	226-236	11	22
β-strand	241-247	7	22
α-helix	252-254	3
β-strand	257-265	9	22
β-strand	270	1	23
β-strand	271-279	9	22
β-strand	282-292	11	22
β-strand	298-307	10	22
β-strand	310-319	10	22
α-helix	320-322	3

Chain F: 8 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	81-86	6
α-helix	94	1
α-helix	96	1
β-strand	99-100	2	31
β-strand	110-115	6	8
β-strand	118-122	5	8
α-helix	126	1
β-strand	127-128	2	31
β-strand	138-148	11	8
β-strand	153-165	13	8
β-strand	169-180	12	8
β-strand	184	1	29
β-strand	188-201	14	8
β-strand	203	1	32
α-helix	204	1
β-strand	205	1	33
α-helix	206-208	3
β-strand	214-223	10	32
β-strand	226-236	11	32
β-strand	241-247	7	32
α-helix	252-254	3
β-strand	257-265	9	32
β-strand	270	1	33
β-strand	271-279	9	32
β-strand	282-292	11	32
β-strand	298-307	10	32
β-strand	310-320	11	32
α-helix	321-322	2

Chain H: 7 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	81-86	6
α-helix	94	1
α-helix	96	1
β-strand	99-101	3	41
β-strand	110-115	6	42
β-strand	118-122	5	42
β-strand	126-128	3	41
α-helix	134	1
β-strand	138-149	12	42
β-strand	152-165	14	42
β-strand	169-180	12	42
β-strand	184	1	39
β-strand	188-201	14	42
β-strand	203	1	43
α-helix	204	1
β-strand	205	1	44
α-helix	206-208	3
β-strand	214-223	10	43
β-strand	226-236	11	43
β-strand	241-247	7	43
α-helix	252-254	3
β-strand	257-265	9	43
β-strand	270	1	44
β-strand	271-279	9	43
β-strand	282-292	11	43
β-strand	298-307	10	43
β-strand	310-319	10	43

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement factor H	A, B, E, G	protein	123	HOMO SAPIENS	P08603 (AlphaFold model)
Factor H binding protein	C, D, F, H	protein	253	NEISSERIA MENINGITIDIS	Q9JXV4 (AlphaFold model)

Sequence of entity 1 (A, B, E, G), FASTA

>2W80_1 COMPLEMENT FACTOR H (chains A, B, E, G)
TLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWS
PAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTP
RCI

Sequence of entity 2 (C, D, F, H), FASTA

>2W80_2 FACTOR H BINDING PROTEIN (chains C, D, F, H)
GGVAADIGAGLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT
GKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVA
KRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLK
SPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNG
IRHIGLAAKQELE

Primary citation

Neisseria Meningitidis Recruits Factor H Using Protein Mimicry of Host Carbohydrates. Schneider, M.C., Prosser, B.E., Caesar, J.J.E. et al. Nature (2009) 458:890. DOI 10.1038/NATURE07769 · PubMed

Other PDB entries of the same protein (UniProt P08603 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4K12 1.08 Å, Structural Basis for Host Specificity of Factor H Binding by Streptococcus pneumoniae
3R62 1.52 Å, Structure of complement regulator Factor H mutant, T1184R.
3KZJ 1.65 Å, Structure of complement Factor H variant R1203A
2G7I 1.75 Å, Structure of Human Complement Factor H Carboxyl Terminal Domains 19-20: a Basis for…
3SW0 1.8 Å, Structure of the C-terminal region (modules 18-20) of complement regulator Factor H
6ATG 1.8 Å, Insights to complement factor H recruitment by the borrelial CspZ protein as revealed by…
9MLU 1.82 Å, FbaA with Factor H 6-7 domain
9MMX 1.9 Å, M6 protein with Factor H 6-7 domain
3KXV 2.0 Å, Structure of complement Factor H variant Q1139A
3OXU 2.1 Å, Complement components factor H CCP19-20 and C3d in complex
4ONT 2.15 Å, Ternary host recognition complex of complement factor H, C3d, and sialic acid
6ZH1 2.2 Å, Crystal structure of complex between FH19-20 and FhbA protein from Borrelia hermsii

Browse structure collections

About this viewer

MolViewer shows 2W80 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.