4AYE: Complement factor H
Structure of a complex between CCPs 6 and 7 of Human Complement Factor H and Neisseria meningitidis FHbp Variant 1 E283AE304A mutant. Determined by X-ray diffraction at 2.8 Å resolution. Released 7 Nov 2012.
- Method
- X-ray diffraction
- Resolution
- 2.8 Å
- Organisms
- HOMO SAPIENS, NEISSERIA MENINGITIDIS MC58
- Chains
- 6
- Atoms
- 8,654
- Mol. weight
- 127.16 kDa
- Released
- 7 Nov 2012
Explore 4AYE in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
4AYE contains 41 α-helices and 110 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 6 helices, 18 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 322-324 | 3 | |
| β-strand | 325 | 1 | 1 |
| α-helix | 326-328 | 3 | |
| β-strand | 333-335 | 3 | 2 |
| α-helix | 338-341 | 4 | |
| α-helix | 342-344 | 3 | |
| β-strand | 347 | 1 | 1 |
| β-strand | 352-357 | 6 | 2 |
| β-strand | 361-362 | 2 | 3 |
| β-strand | 369-375 | 7 | 2 |
| β-strand | 378-380 | 3 | 2 |
| β-strand | 386-387 | 2 | 3 |
| β-strand | 388-390 | 3 | 4 |
| α-helix | 391-393 | 3 | |
| β-strand | 397 | 1 | 5 |
| β-strand | 404 | 1 | 6 |
| β-strand | 405-407 | 3 | 4 |
| β-strand | 411-413 | 3 | 7 |
| β-strand | 416 | 1 | 5 |
| α-helix | 417 | 1 | |
| β-strand | 422 | 1 | 8 |
| β-strand | 426 | 1 | 8 |
| β-strand | 428-431 | 4 | 7 |
| β-strand | 436-437 | 2 | 7 |
Chain B: 5 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 325 | 1 | 9 |
| α-helix | 326-328 | 3 | |
| β-strand | 333-335 | 3 | 10 |
| α-helix | 338-341 | 4 | |
| α-helix | 342-344 | 3 | |
| β-strand | 347 | 1 | 9 |
| β-strand | 352-357 | 6 | 10 |
| β-strand | 361-362 | 2 | 11 |
| β-strand | 369-375 | 7 | 10 |
| β-strand | 378-380 | 3 | 10 |
| β-strand | 386-387 | 2 | 11 |
| β-strand | 388-390 | 3 | 12 |
| α-helix | 391-393 | 3 | |
| β-strand | 397 | 1 | 13 |
| β-strand | 405-407 | 3 | 12 |
| β-strand | 411-413 | 3 | 14 |
| β-strand | 416 | 1 | 13 |
| α-helix | 417 | 1 | |
| β-strand | 428-432 | 5 | 14 |
| β-strand | 435-437 | 3 | 14 |
Chain C: 8 helices, 20 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 81-86 | 6 | |
| α-helix | 94 | 1 | |
| α-helix | 96 | 1 | |
| β-strand | 98-100 | 3 | 15 |
| β-strand | 109-115 | 7 | 16 |
| β-strand | 118-122 | 5 | 16 |
| β-strand | 127-129 | 3 | 15 |
| α-helix | 130-132 | 3 | |
| α-helix | 134 | 1 | |
| β-strand | 138-149 | 12 | 16 |
| β-strand | 152-165 | 14 | 16 |
| β-strand | 169-180 | 12 | 16 |
| β-strand | 188-189 | 2 | 16 |
| β-strand | 194-201 | 8 | 16 |
| β-strand | 203 | 1 | 17 |
| α-helix | 204 | 1 | |
| β-strand | 205 | 1 | 18 |
| α-helix | 206-208 | 3 | |
| β-strand | 214-223 | 10 | 17 |
| β-strand | 226-236 | 11 | 17 |
| β-strand | 241-247 | 7 | 17 |
| α-helix | 252-254 | 3 | |
| β-strand | 257-265 | 9 | 17 |
| β-strand | 270 | 1 | 18 |
| β-strand | 271-279 | 9 | 17 |
| β-strand | 282-292 | 11 | 17 |
| β-strand | 298-307 | 10 | 17 |
| β-strand | 310-319 | 10 | 17 |
Chain D: 8 helices, 21 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 81-86 | 6 | |
| α-helix | 94 | 1 | |
| α-helix | 96 | 1 | |
| β-strand | 98-100 | 3 | 19 |
| β-strand | 109-115 | 7 | 20 |
| β-strand | 118-122 | 5 | 20 |
| β-strand | 127-129 | 3 | 19 |
| α-helix | 130-132 | 3 | |
| α-helix | 134 | 1 | |
| β-strand | 138-149 | 12 | 20 |
| β-strand | 152-165 | 14 | 20 |
| β-strand | 169-180 | 12 | 20 |
| β-strand | 184 | 1 | 6 |
| β-strand | 188-189 | 2 | 20 |
| β-strand | 194-201 | 8 | 20 |
| β-strand | 203 | 1 | 21 |
| α-helix | 204 | 1 | |
| β-strand | 205 | 1 | 22 |
| α-helix | 206-208 | 3 | |
| β-strand | 214-223 | 10 | 21 |
| β-strand | 226-236 | 11 | 21 |
| β-strand | 241-247 | 7 | 21 |
| α-helix | 252-254 | 3 | |
| β-strand | 257-265 | 9 | 21 |
| β-strand | 270 | 1 | 22 |
| β-strand | 271-279 | 9 | 21 |
| β-strand | 282-292 | 11 | 21 |
| β-strand | 298-307 | 10 | 21 |
| β-strand | 310-319 | 10 | 21 |
Chain E: 6 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 325 | 1 | 23 |
| α-helix | 326-328 | 3 | |
| β-strand | 333-335 | 3 | 24 |
| α-helix | 338-341 | 4 | |
| α-helix | 342-344 | 3 | |
| β-strand | 347 | 1 | 23 |
| β-strand | 352-357 | 6 | 24 |
| β-strand | 361-362 | 2 | 25 |
| β-strand | 369-375 | 7 | 24 |
| β-strand | 378-380 | 3 | 24 |
| β-strand | 386-387 | 2 | 25 |
| β-strand | 388-390 | 3 | 26 |
| α-helix | 391-393 | 3 | |
| β-strand | 397 | 1 | 27 |
| β-strand | 405-407 | 3 | 26 |
| β-strand | 411-413 | 3 | 28 |
| β-strand | 416 | 1 | 27 |
| α-helix | 417 | 1 | |
| α-helix | 423-425 | 3 | |
| β-strand | 428-432 | 5 | 28 |
| β-strand | 435-437 | 3 | 28 |
Chain F: 8 helices, 21 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 81-86 | 6 | |
| α-helix | 88-89 | 2 | |
| α-helix | 96 | 1 | |
| β-strand | 99-100 | 2 | 29 |
| β-strand | 109-115 | 7 | 30 |
| β-strand | 118-122 | 5 | 30 |
| β-strand | 127-128 | 2 | 29 |
| α-helix | 130-132 | 3 | |
| α-helix | 134 | 1 | |
| β-strand | 138-149 | 12 | 30 |
| β-strand | 152-165 | 14 | 30 |
| β-strand | 169-180 | 12 | 30 |
| β-strand | 188-189 | 2 | 30 |
| β-strand | 190 | 1 | 20 |
| β-strand | 194-201 | 8 | 30 |
| β-strand | 203 | 1 | 31 |
| α-helix | 204 | 1 | |
| β-strand | 205 | 1 | 32 |
| α-helix | 206-208 | 3 | |
| β-strand | 214-223 | 10 | 31 |
| β-strand | 226-236 | 11 | 31 |
| β-strand | 241-247 | 7 | 31 |
| α-helix | 252-254 | 3 | |
| β-strand | 257-265 | 9 | 31 |
| β-strand | 270 | 1 | 32 |
| β-strand | 271-279 | 9 | 31 |
| β-strand | 282-292 | 11 | 31 |
| β-strand | 298-307 | 10 | 31 |
| β-strand | 310-319 | 10 | 31 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Complement factor H | A, B, E | protein | 125 | HOMO SAPIENS | P08603 (AlphaFold model) |
| Factor H binding protein | C, D, F | protein | 257 | NEISSERIA MENINGITIDIS MC58 | Q9JXV4 (AlphaFold model) |
Sequence of entity 1 (A, B, E), FASTA
>4AYE_1 COMPLEMENT FACTOR H (chains A, B, E)
MGTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDG
WSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSP
TPRCI
Sequence of entity 2 (C, D, F), FASTA
>4AYE_2 FACTOR H BINDING PROTEIN (chains C, D, F)
MVAADIGAGLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTG
KLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAK
RQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKS
PELNVDLAAADIKPDGKRHAVISGSVLYNQAAKGSYSLGIFGGKAQEVAGSAAVKTVNGI
RHIGLAAKQELHHHHHH
Primary citation
Design and Evaluation of Meningococcal Vaccines Through Structure-Based Modification of Host and Pathogen Molecules. Johnson, S., Tan, L., Van Der Veen, S. et al. PLoS Pathog (2012) 8:2981. DOI 10.1371/JOURNAL.PPAT.1002981 · PubMed
Other PDB entries of the same protein (UniProt P08603 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 4K12 1.08 Å, Structural Basis for Host Specificity of Factor H Binding by Streptococcus pneumoniae
- 3R62 1.52 Å, Structure of complement regulator Factor H mutant, T1184R.
- 3KZJ 1.65 Å, Structure of complement Factor H variant R1203A
- 2G7I 1.75 Å, Structure of Human Complement Factor H Carboxyl Terminal Domains 19-20: a Basis for…
- 3SW0 1.8 Å, Structure of the C-terminal region (modules 18-20) of complement regulator Factor H
- 6ATG 1.8 Å, Insights to complement factor H recruitment by the borrelial CspZ protein as revealed by…
- 9MLU 1.82 Å, FbaA with Factor H 6-7 domain
- 9MMX 1.9 Å, M6 protein with Factor H 6-7 domain
- 3KXV 2.0 Å, Structure of complement Factor H variant Q1139A
- 3OXU 2.1 Å, Complement components factor H CCP19-20 and C3d in complex
- 4ONT 2.15 Å, Ternary host recognition complex of complement factor H, C3d, and sialic acid
- 6ZH1 2.2 Å, Crystal structure of complex between FH19-20 and FhbA protein from Borrelia hermsii
Browse structure collections
About this viewer
MolViewer shows 4AYE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.