2YH3: BamB from E. coli

The structure of BamB from E. coli. Determined by X-ray diffraction at 2.6 Å resolution. Released 25 May 2011.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: ESCHERICHIA COLI
Chains: 1
Atoms: 2,782
Mol. weight: 40.66 kDa
Released: 25 May 2011

Explore 2YH3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2YH3 contains 4 α-helices and 36 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 36 β-strands

Element	Residues	Length	Sheet
α-helix	15-18	4
β-strand	25-31	7	1
β-strand	47-49	3	2
β-strand	52-56	5	2
β-strand	61-66	6	2
β-strand	72-77	6	2
β-strand	80	1	3
α-helix	86-87	2
β-strand	88	1	3
α-helix	89	1
β-strand	92-99	8	4
β-strand	102-107	6	4
β-strand	111-116	6	4
β-strand	122-127	6	4
β-strand	137-139	3	5
β-strand	142-146	5	5
β-strand	151-156	6	5
β-strand	162-167	6	5
β-strand	182-184	3	6
β-strand	187-190	4	6
β-strand	196-201	6	6
β-strand	206-212	7	6
β-strand	233-235	3	7
β-strand	238-242	5	7
β-strand	248-252	5	7
β-strand	258-262	5	7
β-strand	267-273	7	8
β-strand	276-281	6	8
β-strand	286-290	5	8
β-strand	296-300	5	8
β-strand	312-314	3	9
β-strand	317-321	5	9
β-strand	326-330	5	9
β-strand	337-342	6	9
β-strand	348	1	10
α-helix	351-352	2
β-strand	353-355	3	1
β-strand	358-362	5	1
β-strand	363	1	10
β-strand	368-373	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lipoprotein yfgl	A	protein	379	ESCHERICHIA COLI	P77774 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2YH3_1 LIPOPROTEIN YFGL (chains A)
LFNSEEDVVKSSPLPTVENQFTPTTAWSTSVGSGIGNFYSNLHPALADNVVYAADRAGLV
KALNADDGKEIWSVSLAEKDGWFSKEPALLSGGVTVSGGHVYIGSEKAQVYALNTSDGTV
AWQTKVAGEALSRPVVSDGLVLIHTSNGQLQALNEADGAVKWTVNLDMPSLSLRGESAPT
TAFGAAVVGGDNGRVSAVLMEQGQMIWQQRISQATGSTEIDRLSDVDTTPVVVNGVVFAL
AYNGNLTALDLRSGQIMWKRELGSVNDFIVDGNRIYLVDQNDRVMALTIDGGVTLWTQSD
LLHRLLTSPVLYNGNLVVGDSEGYLHWINVEDGRFVAQQKVDSSGFQTEPVAADGKLLIQ
AKDGTVYSITRADHHHHHH

Primary citation

Structural Basis of Outer Membrane Protein Biogenesis in Bacteria. Albrecht, R., Zeth, K. J Biol Chem (2011) 286:27792. DOI 10.1074/JBC.M111.238931 · PubMed

Other PDB entries of the same protein (UniProt P77774 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3Q7M 1.65 Å, The crystal structure of BamB from the BAM complex in spacegroup I222
3Q7N 1.77 Å, The crystal structure of BamB from the BAM complex in spacegroup P212121
3PRW 1.8 Å, Crystal structure of the lipoprotein BamB
3Q7O 2.09 Å, The crystal structure of BamB from the BAM complex in spacegroup P213
2YMS 2.1 Å, Structure and assembly of a b-propeller with nine blades and a new conserved repetitive…
4XGA 2.15 Å, Crystal structure of BamB and BamA P3-5 complex from E.coli
3P1L 2.6 Å, Crystal structure of Escherichia coli BamB, a lipoprotein component of the beta-barrel…
9CNW 2.6 Å, CryoEM structure of the APO-BAM complex in DDM detergent
9HG6 2.73 Å, BAM-SurA complex in the swing-in state
9HG5 2.82 Å, BAM-SurA complex in the swing-in state with full length BamC resolved
9HG7 2.83 Å, BAM-SurA complex in the swing-out state
9HG9 2.88 Å, BAM-SurA-darobactin complex in the swing-in state

Browse structure collections

About this viewer

MolViewer shows 2YH3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.