3P1L: Lipoprotein yfgL

Crystal structure of Escherichia coli BamB, a lipoprotein component of the beta-barrel assembly machinery complex, native crystals. Determined by X-ray diffraction at 2.6 Å resolution. Released 22 Dec 2010.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Escherichia coli
Chains: 1
Atoms: 2,792
Mol. weight: 42.1 kDa
Released: 22 Dec 2010

Explore 3P1L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3P1L contains 5 α-helices and 36 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 36 β-strands

Element	Residues	Length	Sheet
α-helix	32-34	3
β-strand	46-50	5	1
β-strand	66-68	3	2
β-strand	71-75	5	2
β-strand	80-85	6	2
β-strand	91-96	6	2
β-strand	99-100	2	3
α-helix	105	1
β-strand	106-107	2	3
α-helix	108	1
β-strand	111-118	8	4
β-strand	121-126	6	4
β-strand	130-135	6	4
β-strand	141-146	6	4
β-strand	156-158	3	5
β-strand	161-165	5	5
β-strand	170-175	6	5
β-strand	181-186	6	5
β-strand	201-203	3	6
β-strand	206-209	4	6
β-strand	215-220	6	6
β-strand	225-231	7	6
α-helix	234-235	2
α-helix	240-242	3
β-strand	252-254	3	7
β-strand	257-261	5	7
β-strand	267-271	5	7
β-strand	277-281	5	7
β-strand	286-291	6	8
β-strand	295-300	6	8
β-strand	305-309	5	8
β-strand	315-319	5	8
β-strand	331-333	3	9
β-strand	336-340	5	9
β-strand	345-350	6	9
β-strand	356-361	6	9
β-strand	367	1	10
β-strand	372-374	3	1
β-strand	377-381	5	1
β-strand	382	1	10
β-strand	387-390	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lipoprotein yfgL	A	protein	393	Escherichia coli	P77774 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3P1L_1 Lipoprotein yfgL (chains A)
MGSSHHHHHHSSGLVPRGSHMSLFNSEEDVVKMSPLPTVENQFTPTTAWSTSVGSGIGNF
YSNLHPALADNVVYAADRAGLVKALNADDGKEIWSVSLAEKDGWFSKEPALLSGGVTVSG
GHVYIGSEKAQVYALNTSDGTVAWQTKVAGEALSRPVVSDGLVLIHTSNGQLQALNEADG
AVKWTVNLDMPSLSLRGESAPTTAFGAAVVGGDNGRVSAVLMEQGQMIWQQRISQATGST
EIDRLSDVDTTPVVVNGVVFALAYNGNLTALDLRSGQIMWKRELGSVNDFIVDGNRIYLV
DQNDRVMALTIDGGVTLWTQSDLLHRLLTSPVLYNGNLVVGDSEGYLHWINVEDGRFVAQ
QKVDSSGFQTEPVAADGKLLIQAKDGTVYSITR

Primary citation

Crystal structure of Escherichia coli BamB, a lipoprotein component of the beta-barrel assembly machinery complex, native crystals. Kim, K.H., Paetzel, M. J Mol Biol (2011) 406:667-678. DOI 10.1016/j.jmb.2010.12.020 · PubMed

Other PDB entries of the same protein (UniProt P77774 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3Q7M 1.65 Å, The crystal structure of BamB from the BAM complex in spacegroup I222
3Q7N 1.77 Å, The crystal structure of BamB from the BAM complex in spacegroup P212121
3PRW 1.8 Å, Crystal structure of the lipoprotein BamB
3Q7O 2.09 Å, The crystal structure of BamB from the BAM complex in spacegroup P213
2YMS 2.1 Å, Structure and assembly of a b-propeller with nine blades and a new conserved repetitive…
4XGA 2.15 Å, Crystal structure of BamB and BamA P3-5 complex from E.coli
2YH3 2.6 Å, The structure of BamB from E. coli
9CNW 2.6 Å, CryoEM structure of the APO-BAM complex in DDM detergent
9HG6 2.73 Å, BAM-SurA complex in the swing-in state
9HG5 2.82 Å, BAM-SurA complex in the swing-in state with full length BamC resolved
9HG7 2.83 Å, BAM-SurA complex in the swing-out state
9HG9 2.88 Å, BAM-SurA-darobactin complex in the swing-in state

Browse structure collections

About this viewer

MolViewer shows 3P1L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.