Crystal structure of Escherichia coli BamB, a lipoprotein component of the beta-barrel assembly machinery complex, native crystals. Determined by X-ray diffraction at 2.6 Å resolution. Released 22 Dec 2010.
Explore 3P1L in 3D Show helices and sheets RCSB PDB PDBe
3P1L contains 5 α-helices and 36 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 32-34 | 3 | |
| β-strand | 46-50 | 5 | 1 |
| β-strand | 66-68 | 3 | 2 |
| β-strand | 71-75 | 5 | 2 |
| β-strand | 80-85 | 6 | 2 |
| β-strand | 91-96 | 6 | 2 |
| β-strand | 99-100 | 2 | 3 |
| α-helix | 105 | 1 | |
| β-strand | 106-107 | 2 | 3 |
| α-helix | 108 | 1 | |
| β-strand | 111-118 | 8 | 4 |
| β-strand | 121-126 | 6 | 4 |
| β-strand | 130-135 | 6 | 4 |
| β-strand | 141-146 | 6 | 4 |
| β-strand | 156-158 | 3 | 5 |
| β-strand | 161-165 | 5 | 5 |
| β-strand | 170-175 | 6 | 5 |
| β-strand | 181-186 | 6 | 5 |
| β-strand | 201-203 | 3 | 6 |
| β-strand | 206-209 | 4 | 6 |
| β-strand | 215-220 | 6 | 6 |
| β-strand | 225-231 | 7 | 6 |
| α-helix | 234-235 | 2 | |
| α-helix | 240-242 | 3 | |
| β-strand | 252-254 | 3 | 7 |
| β-strand | 257-261 | 5 | 7 |
| β-strand | 267-271 | 5 | 7 |
| β-strand | 277-281 | 5 | 7 |
| β-strand | 286-291 | 6 | 8 |
| β-strand | 295-300 | 6 | 8 |
| β-strand | 305-309 | 5 | 8 |
| β-strand | 315-319 | 5 | 8 |
| β-strand | 331-333 | 3 | 9 |
| β-strand | 336-340 | 5 | 9 |
| β-strand | 345-350 | 6 | 9 |
| β-strand | 356-361 | 6 | 9 |
| β-strand | 367 | 1 | 10 |
| β-strand | 372-374 | 3 | 1 |
| β-strand | 377-381 | 5 | 1 |
| β-strand | 382 | 1 | 10 |
| β-strand | 387-390 | 4 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Lipoprotein yfgL | A | protein | 393 | Escherichia coli | P77774 (AlphaFold model) |
>3P1L_1 Lipoprotein yfgL (chains A) MGSSHHHHHHSSGLVPRGSHMSLFNSEEDVVKMSPLPTVENQFTPTTAWSTSVGSGIGNF YSNLHPALADNVVYAADRAGLVKALNADDGKEIWSVSLAEKDGWFSKEPALLSGGVTVSG GHVYIGSEKAQVYALNTSDGTVAWQTKVAGEALSRPVVSDGLVLIHTSNGQLQALNEADG AVKWTVNLDMPSLSLRGESAPTTAFGAAVVGGDNGRVSAVLMEQGQMIWQQRISQATGST EIDRLSDVDTTPVVVNGVVFALAYNGNLTALDLRSGQIMWKRELGSVNDFIVDGNRIYLV DQNDRVMALTIDGGVTLWTQSDLLHRLLTSPVLYNGNLVVGDSEGYLHWINVEDGRFVAQ QKVDSSGFQTEPVAADGKLLIQAKDGTVYSITR
Crystal structure of Escherichia coli BamB, a lipoprotein component of the beta-barrel assembly machinery complex, native crystals. Kim, K.H., Paetzel, M. J Mol Biol (2011) 406:667-678. DOI 10.1016/j.jmb.2010.12.020 · PubMed
Other PDB entries of the same protein (UniProt P77774 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3P1L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.