4XGA: BamB and BamA P3-5 complex from E.coli

Crystal structure of BamB and BamA P3-5 complex from E.coli. Determined by X-ray diffraction at 2.15 Å resolution. Released 20 Jan 2016.

Method: X-ray diffraction
Resolution: 2.15 Å
Organism: Escherichia coli (strain K12)
Chains: 2
Atoms: 4,283
Mol. weight: 68.06 kDa
Ligands: CA
Released: 20 Jan 2016

Explore 4XGA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4XGA contains 12 α-helices and 47 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 37 β-strands

Element	Residues	Length	Sheet
α-helix	33-37	5
β-strand	45-50	6	1
β-strand	66-68	3	2
β-strand	71-75	5	2
β-strand	80-85	6	2
β-strand	91-96	6	2
β-strand	111-118	8	3
β-strand	121-126	6	3
β-strand	130-135	6	3
β-strand	141-146	6	3
β-strand	151	1	4
α-helix	154-155	2
β-strand	156-158	3	5
β-strand	161-165	5	5
β-strand	166	1	4
β-strand	170-175	6	5
β-strand	181-186	6	5
β-strand	193-194	2	6
α-helix	198-200	3
β-strand	201-203	3	7
β-strand	206-210	5	7
β-strand	215-220	6	7
β-strand	225-231	7	7
α-helix	250-251	2
β-strand	252-254	3	8
β-strand	257-261	5	8
β-strand	267-271	5	8
β-strand	277-281	5	8
β-strand	290-292	3	9
β-strand	295-299	5	9
β-strand	305-309	5	9
β-strand	315-319	5	9
α-helix	327-330	4
β-strand	331-333	3	10
β-strand	336-340	5	10
β-strand	345-350	6	10
β-strand	356-361	6	10
β-strand	367	1	11
α-helix	370-371	2
β-strand	372-374	3	1
β-strand	377-381	5	1
β-strand	382	1	11
β-strand	387-391	5	1

Chain B: 6 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	176-183	8	6
α-helix	190-194	5
β-strand	213	1	6
α-helix	216-231	16
β-strand	239-247	9	6
β-strand	253-261	9	6
β-strand	267-276	10	12
α-helix	281-285	5
α-helix	294	1
β-strand	295	1	12
α-helix	296	1
α-helix	298-313	16
β-strand	317	1	13
β-strand	321-329	9	12
β-strand	334-342	9	12
β-strand	346	1	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer membrane protein assembly factor BamB	A	protein	373	Escherichia coli (strain K12)	P77774 (AlphaFold model)
Outer membrane protein assembly factor BamA	B	protein	246	Escherichia coli (strain K12)	P0A940 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4XGA_1 Outer membrane protein assembly factor BamB (chains A)
CSLFNSEEDVVKMSPLPTVENQFTPTTAWSTSVGSGIGNFYSNLHPALADNVVYAADRAG
LVKALNADDGKEIWSVSLAEKDGWFSKEPALLSGGVTVSGGHVYIGSEKAQVYALNTSDG
TVAWQTKVAGEALSRPVVSDGLVLIHTSNGQLQALNEADGAVKWTVNLDMPSLSLRGESA
PTTAFGAAVVGGDNGRVSAVLMEQGQMIWQQRISQATGSTEIDRLSDVDTTPVVVNGVVF
ALAYNGNLTALDLRSGQIMWKRELGSVNDFIVDGNRIYLVDQNDRVMALTIDGGVTLWTQ
SDLLHRLLTSPVLYNGNLVVGDSEGYLHWINVEDGRFVAQQKVDSSGFQTEPVAADGKLL
IQAKDGTVYSITR

Sequence of entity 2 (B), FASTA

>4XGA_2 Outer membrane protein assembly factor BamA (chains B)
AEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRG
YARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGE
LYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRF
EGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDV
VYKVKE

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Primary citation

Structural basis for the interaction of BamB with the POTRA3-4 domains of BamA. Chen, Z., Zhan, L.H., Hou, H.F. et al. Acta Crystallogr D Struct Biol (2016) 72:236-244. DOI 10.1107/S2059798315024729 · PubMed

Other PDB entries of the same protein (UniProt P77774 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3Q7M 1.65 Å, The crystal structure of BamB from the BAM complex in spacegroup I222
3Q7N 1.77 Å, The crystal structure of BamB from the BAM complex in spacegroup P212121
3PRW 1.8 Å, Crystal structure of the lipoprotein BamB
3Q7O 2.09 Å, The crystal structure of BamB from the BAM complex in spacegroup P213
2YMS 2.1 Å, Structure and assembly of a b-propeller with nine blades and a new conserved repetitive…
2YH3 2.6 Å, The structure of BamB from E. coli
3P1L 2.6 Å, Crystal structure of Escherichia coli BamB, a lipoprotein component of the beta-barrel…
9CNW 2.6 Å, CryoEM structure of the APO-BAM complex in DDM detergent
9HG6 2.73 Å, BAM-SurA complex in the swing-in state
9HG5 2.82 Å, BAM-SurA complex in the swing-in state with full length BamC resolved
9HG7 2.83 Å, BAM-SurA complex in the swing-out state
9HG9 2.88 Å, BAM-SurA-darobactin complex in the swing-in state

Browse structure collections

About this viewer

MolViewer shows 4XGA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.