The crystal structure of BamB from the BAM complex in spacegroup P213. Determined by X-ray diffraction at 2.09 Å resolution. Released 9 Feb 2011.
Explore 3Q7O in 3D Show helices and sheets RCSB PDB PDBe
3Q7O contains 3 α-helices and 38 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 22-26 | 5 | |
| β-strand | 45-50 | 6 | 1 |
| β-strand | 66-68 | 3 | 2 |
| β-strand | 71-75 | 5 | 2 |
| β-strand | 80-85 | 6 | 2 |
| β-strand | 91-96 | 6 | 2 |
| β-strand | 99 | 1 | 3 |
| α-helix | 105-106 | 2 | |
| β-strand | 107 | 1 | 3 |
| β-strand | 111-118 | 8 | 4 |
| β-strand | 121-126 | 6 | 4 |
| β-strand | 130-135 | 6 | 4 |
| β-strand | 141-146 | 6 | 4 |
| β-strand | 156-158 | 3 | 5 |
| β-strand | 161-165 | 5 | 5 |
| β-strand | 170-175 | 6 | 5 |
| β-strand | 181-186 | 6 | 5 |
| β-strand | 201-203 | 3 | 6 |
| β-strand | 206-209 | 4 | 6 |
| β-strand | 215-220 | 6 | 6 |
| β-strand | 226-231 | 6 | 6 |
| β-strand | 252-254 | 3 | 7 |
| β-strand | 257-261 | 5 | 7 |
| β-strand | 266-271 | 6 | 7 |
| β-strand | 277-282 | 6 | 7 |
| β-strand | 286-292 | 7 | 8 |
| β-strand | 295-300 | 6 | 8 |
| β-strand | 305-309 | 5 | 8 |
| β-strand | 315-319 | 5 | 8 |
| β-strand | 327 | 1 | 9 |
| β-strand | 331-333 | 3 | 10 |
| β-strand | 336-340 | 5 | 10 |
| β-strand | 341 | 1 | 9 |
| β-strand | 345-350 | 6 | 10 |
| β-strand | 356-361 | 6 | 10 |
| β-strand | 367 | 1 | 11 |
| α-helix | 370-371 | 2 | |
| β-strand | 372-374 | 3 | 1 |
| β-strand | 377-381 | 5 | 1 |
| β-strand | 382 | 1 | 11 |
| β-strand | 387-391 | 5 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Lipoprotein yfgL | A | protein | 376 | Escherichia coli | P77774 (AlphaFold model) |
>3Q7O_1 Lipoprotein yfgL (chains A) GAMGSLFNSEEDVVKMSPLPTVENQFTPTTAWSTSVGSGIGNFYSNLHPALADNVVYAAD RAGLVKALNADDGKEIWSVSLAEKDGWFSKEPALLSGGVTVSGGHVYIGSEKAQVYALNT SDGTVAWQTKVAGEALSRPVVSDGLVLIHTSNGQLQALNEADGAVKWTVNLDMPSLSLRG ESAPTTAFGAAVVGGDNGRVSAVLMEQGQMIWQQRISQATGSTEIDRLSDVDTTPVVVNG VVFALAYNGNLTALDLRSGQIMWKRELGSVNDFIVDGNRIYLVDQNDRVMALTIDGGVTL WTQSDLLHRLLTSPVLYNGNLVVGDSEGYLHWINVEDGRFVAQQKVDSSGFQTEPVAADG KLLIQAKDGTVYSITR
The Crystal Structure of BamB Suggests Interactions with BamA and Its Role within the BAM Complex. Noinaj, N., Fairman, J.W., Buchanan, S.K. J Mol Biol (2011) 407:248-260. DOI 10.1016/j.jmb.2011.01.042 · PubMed
Other PDB entries of the same protein (UniProt P77774 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3Q7O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.