2YRV: AT-rich interactive domain-containing protein 4A

Solution structure of the RBB1NT domain of human RB(retinoblastoma)-binding protein 1. Determined by solution NMR. Released 8 Apr 2008.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 896
Mol. weight: 12.79 kDa
Released: 8 Apr 2008

Explore 2YRV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2YRV contains 5 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	16-20	5	1
α-helix	21	1
β-strand	28-34	7	1
α-helix	43-45	3
β-strand	49-53	5	1
β-strand	59-62	4	1
β-strand	67-68	2	1
α-helix	77-82	6
α-helix	84-94	11
α-helix	107-110	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
AT-rich interactive domain-containing protein 4A	A	protein	117	Homo sapiens	P29374 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2YRV_1 AT-rich interactive domain-containing protein 4A (chains A)
GSSGSSGLNDELLGKVVSVVSATERTEWYPALVISPSCNDDITVKKDQCLVRSFIDSKFY
SIARKDIKEVDILNLPESELSTKPGLQKASIFLKTRVVPDNWKMDISEILESGPSSG

Primary citation

Solution structure of the RBB1NT domain of human RB(retinoblastoma)-binding protein 1. Nameki, N., Saito, K., Koshiba, S. et al. To be published.

Other PDB entries of the same protein (UniProt P29374 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BPH 1.85 Å, Crystal structure of the chromodomain of RBBP1
7V8N 2.05 Å, Crystal structure of the PWWP-ARID domain of ARID4A
7SMC 2.7 Å, p107 pocket domain complexed with ARID4A peptide
2LCC Solution structure of RBBP1 chromobarrel domain
2MAM Solution structure of the interdigitated double Tudor domain of RBBP1
6L87 Solution structure of the tandem PWWP-ARID domains of human RBBP1

Browse structure collections

About this viewer

MolViewer shows 2YRV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.