Solution structure of the second WW domain from the human membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1. MAGI-1. Determined by solution NMR. Released 9 Oct 2007.
Explore 2YSE in 3D Show helices and sheets RCSB PDB PDBe
2YSE contains 2 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-4 | 3 | |
| β-strand | 18-22 | 5 | 1 |
| β-strand | 28-32 | 5 | 1 |
| β-strand | 37-39 | 3 | 1 |
| α-helix | 43-51 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 | A | protein | 60 | Homo sapiens | Q96QZ7 (AlphaFold model) |
>2YSE_1 Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (chains A) GSSGSSGLDSELELPAGWEKIEDPVYGIYYVDHINRKTQYENPVLEAKRKKQLESGPSSG
Solution structure of the second WW domain from the human membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1. MAGI-1. Ohnishi, S., Sato, M., Koshiba, S. et al. To be published.
Other PDB entries of the same protein (UniProt Q96QZ7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2YSE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.