2YX8: Extracellular domain of human RAMP1

Crystal structure of the extracellular domain of human RAMP1. Determined by X-ray diffraction at 2.4 Å resolution. Released 29 Apr 2008.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 1
Atoms: 683
Mol. weight: 10.78 kDa
Released: 29 Apr 2008

Explore 2YX8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2YX8 contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	29-35	7
α-helix	36-41	6
α-helix	42-51	10
α-helix	53-55	3
α-helix	59-80	22
α-helix	87-100	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Receptor activity-modifying protein 1	A	protein	93	Homo sapiens	O60894 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2YX8_1 Receptor activity-modifying protein 1 (chains A)
GSFTSSGCQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEK
LGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVR

Primary citation

Crystal structure of the human receptor activity-modifying protein 1 extracellular domain. Kusano, S., Kukimoto-Niino, M., Akasaka, R. et al. Protein Sci (2008) 17:1907-1914. DOI 10.1110/ps.036012.108 · PubMed

Other PDB entries of the same protein (UniProt O60894 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ZHO 1.6 Å, Crystal structure of a CGRP receptor ectodomain heterodimer with bound high affinity…
8AX7 1.65 Å, Crystal structure of a CGRP receptor ectodomain heterodimer bound to macrocyclic…
7P0F 1.85 Å, Crystal structure of a CGRP receptor ectodomain heterodimer bound to macrocyclic…
8AX6 1.9 Å, Crystal structure of a CGRP receptor ectodomain heterodimer bound to macrocyclic…
6D1U 2.05 Å, Crystal structure of the human CLR:RAMP1 extracellular domain heterodimer in complex…
3N7S 2.1 Å, Crystal structure of the ectodomain complex of the CGRP receptor, a Class-B GPCR,…
7TYF 2.2 Å, Human Amylin1 Receptor in complex with Gs and rat amylin peptide
9BP3 2.2 Å, Human Amylin1 Receptor in complex with Gs and cagrilintide
7P0I 2.3 Å, Crystal structure of a CGRP receptor ectodomain heterodimer bound to macrocyclic…
9AUC 2.4 Å, Human Amylin1 Receptor in Complex with Gs and human Calcitonin Gene-Related Peptide
4RWG 2.44 Å, Crystal structure of the CLR:RAMP1 extracellular domain heterodimer with bound high…
6UMG 2.7 Å, Crystal structure of erenumab Fab bound to the extracellular domain of CGRP receptor

Browse structure collections

About this viewer

MolViewer shows 2YX8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.