3N7S: Calcitonin gene-related peptide type 1 receptor

Crystal structure of the ectodomain complex of the CGRP receptor, a Class-B GPCR, reveals the site of drug antagonism. Determined by X-ray diffraction at 2.1 Å resolution. Released 15 Sept 2010.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,116
Mol. weight: 50.18 kDa
Ligands: 3N6, 3N7
Released: 15 Sept 2010

Explore 3N7S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3N7S contains 21 α-helices and 24 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	33-52	20
α-helix	55-56	2
β-strand	64-65	2	1
β-strand	68-69	2	2
β-strand	74-75	2	2
β-strand	78-79	2	1
β-strand	83-87	5	3
α-helix	88-89	2
β-strand	100-104	5	3
β-strand	105	1	4
α-helix	106	1
β-strand	111	1	4
β-strand	113	1	5
β-strand	120	1	5
β-strand	123	1	3
α-helix	125-127	3

Chain B: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	36-53	18
β-strand	64-65	2	6
α-helix	66-67	2
β-strand	68-69	2	7
β-strand	74-75	2	7
β-strand	78-79	2	6
β-strand	83-87	5	8
α-helix	88-89	2
β-strand	100-104	5	8
β-strand	105	1	9
β-strand	111	1	9
β-strand	113	1	10
β-strand	120	1	10
β-strand	123	1	8

Chain C: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	29-35	7
α-helix	36-40	5
α-helix	41-51	11
α-helix	53-55	3
α-helix	59-80	22
α-helix	87-100	14
α-helix	114-115	2

Chain D: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	29-35	7
α-helix	36-40	5
α-helix	41-51	11
α-helix	53-55	3
β-strand	58	1	11
α-helix	59-80	22
α-helix	87-100	14
β-strand	109	1	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calcitonin gene-related peptide type 1 receptor	A, B	protein	115	Homo sapiens	Q16602 (AlphaFold model)
Receptor activity-modifying protein 1	C, D	protein	96	Homo sapiens	O60894 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3N7S_1 Calcitonin gene-related peptide type 1 receptor (chains A, B)
GSHMELEESPEDSIQLGVTRNKIMTAQYECYQKIMQDPIQQAEGVYCNRTWDGWLCWNDV
AAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCNVNTHE

Sequence of entity 2 (C, D), FASTA

>3N7S_2 Receptor activity-modifying protein 1 (chains C, D)
GSHMACQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLG
CFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGS

Ligands and cofactors

ID	Name	Formula	Copies
3N6	N-{(1S)-5-amino-1-[(4-pyridin-4-ylpiperazin-1-yl)carbonyl]pentyl}-3,5-dibromo-N…	C38 H47 Br2 N9 O5	1
3N7	N~4~-(5-cyclopropyl-1H-pyrazol-3-yl)-N~2~-1H-indazol-5-yl-6-methylpyrimidine-2,…	C18 H18 N8	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Crystal Structure of the Ectodomain Complex of the CGRP Receptor, a Class-B GPCR, Reveals the Site of Drug Antagonism. Ter Haar, E., Koth, C.M., Abdul-Manan, N. et al. Structure (2010) 18:1083-1093. DOI 10.1016/j.str.2010.05.014 · PubMed

Other PDB entries of the same protein (UniProt Q16602 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ZHO 1.6 Å, Crystal structure of a CGRP receptor ectodomain heterodimer with bound high affinity…
8AX7 1.65 Å, Crystal structure of a CGRP receptor ectodomain heterodimer bound to macrocyclic…
4RWF 1.76 Å, Crystal structure of the CLR:RAMP2 extracellular domain heterodimer with bound…
6V2E 1.83 Å, Crystal structure of the human CLR:RAMP2 extracellular domain heterodimer with bound…
7P0F 1.85 Å, Crystal structure of a CGRP receptor ectodomain heterodimer bound to macrocyclic…
8AX6 1.9 Å, Crystal structure of a CGRP receptor ectodomain heterodimer bound to macrocyclic…
6D1U 2.05 Å, Crystal structure of the human CLR:RAMP1 extracellular domain heterodimer in complex…
6UVA 2.3 Å, CryoEM Structure of the active Adrenomedullin 2 receptor G protein complex with…
7P0I 2.3 Å, Crystal structure of a CGRP receptor ectodomain heterodimer bound to macrocyclic…
6UUS 2.4 Å, CryoEM Structure of the active Adrenomedullin 2 receptor G protein complex with…
4RWG 2.44 Å, Crystal structure of the CLR:RAMP1 extracellular domain heterodimer with bound high…
3AQF 2.6 Å, Crystal structure of the human CRLR/RAMP2 extracellular complex

Browse structure collections

About this viewer

MolViewer shows 3N7S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.