2ZRT: Zn2+-bound form of des3-23ALG-2

Crystal structure of Zn2+-bound form of des3-23ALG-2. Determined by X-ray diffraction at 3.3 Å resolution. Released 4 Nov 2008.

Method: X-ray diffraction
Resolution: 3.3 Å
Organism: Homo sapiens
Chains: 8
Atoms: 11,004
Mol. weight: 160.87 kDa
Ligands: ZN
Released: 4 Nov 2008

Explore 2ZRT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ZRT contains 64 α-helices and 38 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	62-69	8
α-helix	87-103	17
α-helix	113-121	9
α-helix	148-168	21
β-strand	175-176	2	1
β-strand	179	1	2
α-helix	180-187	8

Chain B: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	25-35	11
β-strand	43	1	3
α-helix	47-51	5
α-helix	62-69	8
β-strand	80	1	3
α-helix	82-102	21
β-strand	110	1	4
α-helix	112-120	9
α-helix	128-138	11
β-strand	146	1	4
α-helix	148-168	21
β-strand	175	1	2
β-strand	178-179	2	1
α-helix	184-186	3

Chain C: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	26-34	9
β-strand	43-44	2	5
α-helix	45-49	5
β-strand	53	1	6
β-strand	59	1	6
α-helix	62-72	11
β-strand	79-80	2	5
α-helix	82-102	21
β-strand	110	1	7
α-helix	112-120	9
α-helix	128-138	11
β-strand	146	1	7
α-helix	148-168	21
β-strand	175-179	5	8
α-helix	180-187	8

Chain D: 9 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	28-35	8
β-strand	43	1	9
α-helix	45-50	6
α-helix	59-60	2
α-helix	62-72	11
β-strand	80	1	9
α-helix	82-101	20
β-strand	110	1	10
α-helix	112-122	11
α-helix	128-138	11
β-strand	146	1	10
α-helix	148-166	19
β-strand	175-179	5	8
α-helix	180-187	8

Chain E: 8 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	25-35	11
β-strand	43	1	11
α-helix	47-50	4
α-helix	62-72	11
β-strand	80	1	11
α-helix	82-100	19
β-strand	110	1	12
α-helix	112-119	8
α-helix	130-137	8
β-strand	146	1	12
α-helix	148-168	21
β-strand	176-178	3	13
α-helix	180-187	8

Chain F: 9 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	26-35	10
β-strand	43-44	2	14
α-helix	45-49	5
α-helix	59-61	3
α-helix	62-72	11
β-strand	79-80	2	14
α-helix	82-101	20
β-strand	110	1	15
α-helix	112-122	11
α-helix	128-138	11
β-strand	146	1	15
α-helix	148-168	21
β-strand	176-178	3	13
α-helix	180-186	7

Chain G: 8 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	45-48	4
α-helix	59-60	2
α-helix	62-68	7
α-helix	69-71	3
α-helix	85-101	17
β-strand	109-110	2	16
α-helix	112-120	9
α-helix	132-138	7
β-strand	146-147	2	16
α-helix	148-160	13
β-strand	175	1	17

Chain H: 9 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	27-35	9
β-strand	43	1	18
α-helix	45-48	4
α-helix	63-66	4
α-helix	68-71	4
β-strand	80	1	18
α-helix	82-95	14
β-strand	109-110	2	19
α-helix	113-116	4
α-helix	128-130	3
α-helix	133-137	5
β-strand	146-147	2	19
α-helix	148-168	21
β-strand	177	1	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Programmed cell death protein 6	A, B, C, D, E, F, G, H	protein	168	Homo sapiens	O75340 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA

>2ZRT_1 Programmed cell death protein 6 (chains A, B, C, D, E, F, G, H)
DQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFS
EFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGR
GQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	37

Primary citation

Crystallization and X-ray diffraction analysis of N-terminally truncated human ALG-2. Suzuki, H., Kawasaki, M., Kakiuchi, T. et al. Acta Crystallogr Sect F Struct Biol Cryst Commun (2008) 64:974-977. DOI 10.1107/S1744309108030297 · PubMed

Other PDB entries of the same protein (UniProt O75340 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2ZND 1.7 Å, Crystal structure of Ca2+-free form of des3-20ALG-2
2ZNE 2.2 Å, Crystal structure of Zn2+-bound form of des3-23ALG-2 complexed with Alix ABS peptide
5GQQ 2.2 Å, Structure of ALG-2/HEBP2 Complex
3WXA 2.36 Å, X-ray crystal structural analysis of the complex between ALG-2 and Sec31A peptide
2ZN9 2.4 Å, Crystal structure of Ca2+-bound form of des3-20ALG-2
3AAJ 2.4 Å, Crystal structure of Ca2+-bound form of des3-23ALG-2deltaGF122
2ZN8 2.7 Å, Crystal structure of Zn2+-bound form of ALG-2
3AAK 2.7 Å, Crystal structure of Zn2+-bound form of des3-20ALG-2F122A
2ZRS 3.1 Å, Crystal structure of Ca2+-bound form of des3-23ALG-2

Browse structure collections

About this viewer

MolViewer shows 2ZRT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.