3AAK: Zn2+-bound form of des3-20ALG-2F122A

Crystal structure of Zn2+-bound form of des3-20ALG-2F122A. Determined by X-ray diffraction at 2.7 Å resolution. Released 8 Sept 2010.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,404
Mol. weight: 20.28 kDa
Ligands: ZN
Released: 8 Sept 2010

Explore 3AAK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3AAK contains 8 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	26-35	10
β-strand	43-44	2	1
α-helix	45-50	6
α-helix	62-70	9
β-strand	79-80	2	1
α-helix	82-101	20
β-strand	110-111	2	2
α-helix	112-121	10
α-helix	128-138	11
β-strand	145-146	2	2
α-helix	148-168	21
α-helix	180-188	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Programmed cell death protein 6	A	protein	172	Homo sapiens	O75340 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3AAK_1 Programmed cell death protein 6 (chains A)
AALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAG
VNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGAGYRLSDQFHDILIRKFD
RQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3

Primary citation

Molecular basis for defect in Alix-binding by alternatively spliced isoform of ALG-2 (ALG-2DeltaGF122) and structural roles of F122 in target recognition. Inuzuka, T., Suzuki, H., Kawasaki, M. et al. BMC Struct Biol (2010) 10:25-25. DOI 10.1186/1472-6807-10-25 · PubMed

Other PDB entries of the same protein (UniProt O75340 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2ZND 1.7 Å, Crystal structure of Ca2+-free form of des3-20ALG-2
2ZNE 2.2 Å, Crystal structure of Zn2+-bound form of des3-23ALG-2 complexed with Alix ABS peptide
5GQQ 2.2 Å, Structure of ALG-2/HEBP2 Complex
3WXA 2.36 Å, X-ray crystal structural analysis of the complex between ALG-2 and Sec31A peptide
2ZN9 2.4 Å, Crystal structure of Ca2+-bound form of des3-20ALG-2
3AAJ 2.4 Å, Crystal structure of Ca2+-bound form of des3-23ALG-2deltaGF122
2ZN8 2.7 Å, Crystal structure of Zn2+-bound form of ALG-2
2ZRS 3.1 Å, Crystal structure of Ca2+-bound form of des3-23ALG-2
2ZRT 3.3 Å, Crystal structure of Zn2+-bound form of des3-23ALG-2

Browse structure collections

About this viewer

MolViewer shows 3AAK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.