3AAJ: Ca2+-bound form of des3-23ALG-2deltaGF122

Crystal structure of Ca2+-bound form of des3-23ALG-2deltaGF122. Determined by X-ray diffraction at 2.4 Å resolution. Released 8 Sept 2010.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,803
Mol. weight: 39.59 kDa
Ligands: CA
Released: 8 Sept 2010

Explore 3AAJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3AAJ contains 17 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	26-35	10
β-strand	43-44	2	1
α-helix	45-51	7
α-helix	62-72	11
β-strand	79-80	2	1
α-helix	82-102	21
β-strand	110	1	2
α-helix	112-118	7
α-helix	120-122	3
α-helix	126-136	11
β-strand	144	1	2
α-helix	146-166	21
β-strand	173-177	5	3
α-helix	178-186	9

Chain B: 8 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	29-35	7
β-strand	43-44	2	4
α-helix	45-49	5
α-helix	62-72	11
β-strand	79-80	2	4
α-helix	82-102	21
β-strand	110	1	5
α-helix	112-118	7
α-helix	126-136	11
β-strand	144	1	5
α-helix	146-164	19
β-strand	173-177	5	3
α-helix	178-188	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Programmed cell death protein 6	A, B	protein	167	Homo sapiens	O75340 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3AAJ_1 Programmed cell death protein 6 (chains A, B)
ADQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNF
SEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGYRLSDQFHDILIRKFDRQGRG
QIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	6

Primary citation

Molecular basis for defect in Alix-binding by alternatively spliced isoform of ALG-2 (ALG-2DeltaGF122) and structural roles of F122 in target recognition. Inuzuka, T., Suzuki, H., Kawasaki, M. et al. BMC Struct Biol (2010) 10:25-25. DOI 10.1186/1472-6807-10-25 · PubMed

Other PDB entries of the same protein (UniProt O75340 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2ZND 1.7 Å, Crystal structure of Ca2+-free form of des3-20ALG-2
2ZNE 2.2 Å, Crystal structure of Zn2+-bound form of des3-23ALG-2 complexed with Alix ABS peptide
5GQQ 2.2 Å, Structure of ALG-2/HEBP2 Complex
3WXA 2.36 Å, X-ray crystal structural analysis of the complex between ALG-2 and Sec31A peptide
2ZN9 2.4 Å, Crystal structure of Ca2+-bound form of des3-20ALG-2
2ZN8 2.7 Å, Crystal structure of Zn2+-bound form of ALG-2
3AAK 2.7 Å, Crystal structure of Zn2+-bound form of des3-20ALG-2F122A
2ZRS 3.1 Å, Crystal structure of Ca2+-bound form of des3-23ALG-2
2ZRT 3.3 Å, Crystal structure of Zn2+-bound form of des3-23ALG-2

Browse structure collections

About this viewer

MolViewer shows 3AAJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.