2ZV2: PDB entry 2ZV2

Crystal structure of human calcium/calmodulin-dependent protein kinase kinase 2, beta, CaMKK2 kinase domain in complex with STO-609. Determined by X-ray diffraction at 2.4 Å resolution. Released 3 Nov 2009.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,143
Mol. weight: 33.92 kDa
Ligands: 609
Released: 3 Nov 2009

Explore 2ZV2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ZV2 contains 12 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	162-163	2	1
β-strand	166-173	8	1
β-strand	179-185	7	1
β-strand	190-198	9	1
α-helix	233-242	10
β-strand	249	1	2
β-strand	252-257	6	1
β-strand	263-269	7	1
β-strand	275	1	2
α-helix	287-306	20
β-strand	309-310	2	3
α-helix	316-318	3
β-strand	319-321	3	2
β-strand	327-329	3	2
β-strand	336-337	2	3
β-strand	344-345	2	4
α-helix	352-354	3
α-helix	357-359	3
β-strand	367-368	2	4
α-helix	370-386	17
α-helix	396-405	10
α-helix	406-408	3
α-helix	418-427	10
α-helix	436-437	2
α-helix	438-441	4
α-helix	445-448	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calcium/calmodulin-dependent protein kinase kinase 2	A	protein	298	Homo sapiens	Q96RR4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2ZV2_1 Calcium/calmodulin-dependent protein kinase kinase 2 (chains A)
GSSGSSGDCVQLNQYTLKDEIGKGSYGVVKLAYNENDNTYYAMKVLSKKKLIRQAGFPRR
PPPRGTRPAPGGCIQPRGPIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELV
NQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIAD
FGVSNEFKGSDALLSNTVGTPAFMAPESLSETRKIFSGKALDVWAMGVTLYCFVFGQCPF
MDERIMCLHSKIKSQALEFPDQPDIAEDLKDLITRMLDKNPESRIVVPEIKLHPWVTR

Ligands and cofactors

ID	Name	Formula	Copies
609	7-oxo-7H-benzimidazo[2,1-a]benz[de]isoquinoline-3-carboxylic acid	C19 H10 N2 O3	1

Primary citation

Crystal structure of the Ca2+/calmodulin-dependent protein kinase kinase in complex with the inhibitor STO-609. Kukimoto-Niino, M., Yoshikawa, S., Takagi, T. et al. J Biol Chem (2011) 286:22570-22579. DOI 10.1074/jbc.M111.251710 · PubMed

Other PDB entries of the same protein (UniProt Q96RR4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6Y3O 1.5 Å, 14-3-3 Sigma in complex with phosphorylated CAMKK2 peptide
6Y8A 1.5 Å, 14-3-3 Sigma in complex with phosphorylated camkk2{pS511} peptide
8TUC 1.5 Å, Unphosphorylated CaMKK2 in complex with CC-8977
5UYJ 1.6 Å, Crystal Structure of the Human CAMKK2B
5UY6 1.7 Å, Crystal Structure of the Human CAMKK2B
6BQQ 1.8 Å, Crystal Structure of the Human CAMKK2B in complex with BI2526
5VT1 1.9 Å, Crystal Structure of the Human CAMKK2B bound to a thiadiazinone benzamide inhibitor
6BLE 1.9 Å, Crystal Structure of the Human CAMKK2B in complex with CP673451
5YV8 1.93 Å, Structure of CaMKK2 in complex with CKI-002
6BQP 1.95 Å, Crystal Structure of the Human CAMKK2B in complex with Crenolanib
6BKU 2.0 Å, Crystal Structure of the Human CAMKK2B bound to GSK650394
6BQL 2.0 Å, Crystal Structure of the Human CAMKK2B in complex with TAE-226

Browse structure collections

About this viewer

MolViewer shows 2ZV2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.