31LF: HRV virion E2250A mutant

Name: PDB 31LF: HRV virion E2250A mutant
Published: 2026-09-09
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: virus

HRV virion E2250A mutant. Determined by electron microscopy at 2.71 Å resolution. Released 9 Sept 2026.

Method: Electron microscopy
Resolution: 2.71 Å
Organism: rhinovirus B14
Chains: 5
Atoms: 6,682
Mol. weight: 95.29 kDa
Released: 9 Sept 2026

Explore 31LF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

31LF contains 35 α-helices and 63 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain 1: 10 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	18-20	3	1
β-strand	23	1	2
β-strand	31	1	3
β-strand	34-35	2	4
α-helix	37-39	3
α-helix	47-49	3
β-strand	53	1	2
β-strand	56-57	2	1
β-strand	66	1	5
α-helix	67-70	4
β-strand	75-84	10	6
β-strand	99-103	5	7
α-helix	110-116	7
β-strand	119-135	17	6
β-strand	147-152	6	7
α-helix	158-160	3
α-helix	167-169	3
β-strand	175-179	5	7
β-strand	180	1	8
β-strand	182	1	8
β-strand	183-188	6	6
β-strand	197-198	2	6
β-strand	203	1	9
β-strand	204	1	10
β-strand	213	1	10
β-strand	223-228	6	7
β-strand	237-255	19	6
α-helix	257-258	2
β-strand	259	1	11
α-helix	262-263	2
α-helix	275-277	3
α-helix	280-282	3

Chain 2: 11 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	14-18	5	12
β-strand	21-25	5	12
β-strand	31-33	3	13
α-helix	34-36	3
α-helix	41-43	3
α-helix	52-53	2
β-strand	54	1	13
α-helix	57-59	3
β-strand	64-65	2	13
α-helix	66-68	3
β-strand	69-71	3	14
β-strand	78-82	5	15
α-helix	90-98	9
β-strand	99-111	13	13
β-strand	119	1	16
β-strand	121-128	8	15
β-strand	134	1	17
α-helix	144-147	4
β-strand	154-155	2	15
α-helix	159-160	2
β-strand	165	1	17
β-strand	176	1	11
α-helix	178-183	6
β-strand	186-190	5	15
β-strand	196-201	6	13
β-strand	210	1	13
β-strand	215	1	9
β-strand	218-224	7	15
α-helix	227-228	2
β-strand	229	1	16
α-helix	230-231	2
β-strand	238-240	3	14
β-strand	241-254	14	13

Chain 3: 12 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	6-7	2
β-strand	23	1	6
α-helix	30-34	5
β-strand	39-40	2	6
β-strand	42	1	5
α-helix	43-46	4
β-strand	51-52	2	4
α-helix	64-67	4
β-strand	68-71	4	4
β-strand	79-84	6	18
α-helix	90-92	3
α-helix	96-100	5
α-helix	101-103	3
β-strand	104-108	5	19
β-strand	111-117	7	4
β-strand	124-132	9	18
α-helix	133	1
β-strand	134	1	20
β-strand	136	1	20
α-helix	137-139	3
α-helix	142-146	5
β-strand	149-154	6	18
α-helix	155	1
β-strand	160-165	6	4
β-strand	174-175	2	19
β-strand	186-196	11	18
α-helix	197-198	2
β-strand	205-213	9	4
β-strand	218-222	5	19

Chain 4: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	36-38	3
α-helix	51-54	4
β-strand	57	1	13
β-strand	64	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Capsid protein VP1	1	protein	282	rhinovirus B14	P03303 (AlphaFold model)
Genome polyprotein	2	protein	256	rhinovirus B14	A0A5B9MV00
Capsid protein VP3	3	protein	236	rhinovirus B14	P03303 (AlphaFold model)
Capsid protein VP4	4	protein	47	rhinovirus B14	P03303 (AlphaFold model)
RNA (5'-r(papupupupupupupupupupupupupu)-3')	5	RNA	14	rhinovirus B14

Sequence of entity 1 (1), FASTA

>31LF_1 Capsid protein VP1 (chains 1)
EVIVEKTKQTVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDV
ECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSE
YTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFS
VPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRA
KHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY

Sequence of entity 2 (2), FASTA

>31LF_2 Genome polyprotein (chains 2)
CGYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTL
DSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVV
IPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPH
QFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAP
MCTAFSGIRSKSIVPQ

Sequence of entity 3 (3), FASTA

>31LF_3 Capsid protein VP3 (chains 3)
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHT
KDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGP
ALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDT
YTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE

Sequence of entity 4 (4), FASTA

>31LF_4 Capsid protein VP4 (chains 4)
SNQTFTYINYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN

Sequence of entity 5 (5), FASTA

>31LF_5 RNA (5'-R(P*AP*UP*UP*UP*UP*UP*UP*UP*UP*UP*UP*UP*UP*U)-3') (chains 5)
AUUUUUUUUUUUUU

Primary citation

RNA-repelling Anionic Clusters in Human Rhinovirus Cooperate with Cationic Residues to Promote Virion Assembly and Restrain RNA Release. Riomoros-Barahona, V., Martinez-Romero, J.M., Valiente, L. et al. J Mol Biol (2026) 438:169998-169998. DOI 10.1016/j.jmb.2026.169998 · PubMed

Other PDB entries of the same protein (UniProt P03303 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KYZ 1.84 Å, HRV14 3C in complex with single chain antibody YDF
9LGP 2.11 Å, Crystal structure of the HRV B14 3C protease in complex with AG7404
5W3M 2.26 Å, CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar…
6KZ0 2.4 Å, HRV14 3C in complex with single chain antibody GGVV
7BG7 2.4 Å, HRV14 in complex with its receptor ICAM-1
1NCQ 2.5 Å, The structure of HRV14 when complexed with pleconaril, an antiviral compound
5W3E 2.53 Å, CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar…
7BG6 2.6 Å, HRV14 native particle solved by cryoEM
31LE 2.64 Å, HRV E1007A mutant
1K5M 2.7 Å, Crystal Structure of a Human Rhinovirus Type 14:Human Immunodeficiency Virus Type 1 V3…
5W3L 2.71 Å, CryoEM structure of rhinovirus B14 in complex with C5 Fab (4 degrees Celsius, molar…
29UB 2.73 Å, HRV B14 virion

Browse structure collections

About this viewer

MolViewer shows 31LF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.