6KZ0: HRV14 3C

HRV14 3C in complex with single chain antibody GGVV. Determined by X-ray diffraction at 2.4 Å resolution. Released 27 May 2020.

Method: X-ray diffraction
Resolution: 2.4 Å
Organisms: Human rhinovirus 14, Homo sapiens
Chains: 12
Atoms: 12,416
Mol. weight: 185.49 kDa
Released: 27 May 2020

Explore 6KZ0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6KZ0 contains 65 α-helices and 148 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	2-13	12
β-strand	15-20	6	1
β-strand	23-31	9	1
β-strand	32	1	2
β-strand	34-38	5	1
α-helix	39-41	3
β-strand	46-49	4	1
β-strand	52-61	10	1
β-strand	72-78	7	1
α-helix	82	1
β-strand	83	1	2
α-helix	84	1
α-helix	87-89	3
β-strand	90	1	3
β-strand	98-105	8	3
β-strand	108-120	13	3
β-strand	135-137	3	3
α-helix	141-142	2
α-helix	148	1
β-strand	149-152	4	3
β-strand	155-163	9	3
β-strand	168-172	5	3
α-helix	173	1
α-helix	175-177	3

Chain B: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	7-8	2	4
β-strand	12-14	3	5
β-strand	20-25	6	4
β-strand	36-41	6	5
β-strand	47-54	8	5
α-helix	55-57	3
β-strand	59-62	4	5
α-helix	64-66	3
β-strand	70-75	6	4
β-strand	80-85	6	4
α-helix	90-92	3
β-strand	94-101	8	5
β-strand	111-114	4	5
β-strand	118-122	5	5

Chains C, F, I and L: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	6
β-strand	10-13	4	7
β-strand	19-25	7	6
β-strand	33-38	6	7
β-strand	45-49	5	7
β-strand	53-54	2	7
α-helix	55	1
β-strand	62-67	6	6
β-strand	70-75	6	6
α-helix	80-82	3
β-strand	84-90	7	7
α-helix	97	1
β-strand	98	1	7
α-helix	99	1
β-strand	102-106	5	7

Chain D: 6 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	1-13	13
β-strand	15-20	6	8
β-strand	23-31	9	8
β-strand	32	1	9
β-strand	34-38	5	8
α-helix	39-41	3
β-strand	46-49	4	8
β-strand	52-61	10	8
β-strand	72-77	6	8
β-strand	83	1	9
α-helix	87-89	3
β-strand	90	1	10
β-strand	98-105	8	10
β-strand	108-120	13	10
β-strand	135-137	3	10
α-helix	148	1
β-strand	149-152	4	10
β-strand	155-163	9	10
β-strand	168-172	5	10
α-helix	173	1
α-helix	175-177	3

Chain E: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	7-8	2	11
β-strand	12-14	3	12
β-strand	20-25	6	11
α-helix	28-31	4
β-strand	36-41	6	12
β-strand	47-54	8	12
α-helix	55-57	3
β-strand	59-62	4	12
α-helix	64-66	3
β-strand	70-75	6	11
β-strand	80-85	6	11
α-helix	90-92	3
β-strand	94-101	8	12
β-strand	111-114	4	12
β-strand	118-122	5	12

Chain G: 9 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	1-13	13
β-strand	15-20	6	15
β-strand	23-31	9	15
β-strand	32	1	16
β-strand	34-38	5	15
α-helix	39-41	3
β-strand	46-49	4	15
β-strand	52-61	10	15
β-strand	72-78	7	15
α-helix	82	1
β-strand	83	1	16
α-helix	84	1
α-helix	87-89	3
β-strand	90	1	17
β-strand	98-105	8	17
β-strand	108-119	12	17
β-strand	135-138	4	17
α-helix	141-142	2
α-helix	148	1
β-strand	149-152	4	17
β-strand	155-163	9	17
β-strand	167-172	6	17
α-helix	173	1
α-helix	175-177	3

Chain H: 5 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	7-8	2	18
α-helix	9	1
β-strand	12-14	3	19
β-strand	20-25	6	18
α-helix	28-33	6
β-strand	36-41	6	19
β-strand	47-54	8	19
α-helix	55-57	3
β-strand	59-62	4	19
α-helix	64-66	3
β-strand	70-75	6	18
β-strand	80-85	6	18
α-helix	90-92	3
β-strand	94-101	8	19
β-strand	111-114	4	19
β-strand	118-122	5	19

Chain J: 9 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	2-13	12
β-strand	15-20	6	22
β-strand	23-31	9	22
β-strand	32	1	23
β-strand	34-38	5	22
α-helix	39-41	3
β-strand	46-49	4	22
β-strand	52-61	10	22
β-strand	72-77	6	22
α-helix	82	1
β-strand	83	1	23
α-helix	84	1
α-helix	87-89	3
β-strand	90	1	24
β-strand	98-105	8	24
β-strand	108-120	13	24
β-strand	135-137	3	24
α-helix	141-142	2
α-helix	148	1
β-strand	149-152	4	24
β-strand	155-163	9	24
β-strand	168-172	5	24
α-helix	173	1
α-helix	175-177	3

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Genome polyprotein	A, D, G, J	protein	184	Human rhinovirus 14	P03303 (AlphaFold model)
GGVV H chain	B, E, H, K	protein	142	Homo sapiens
GGVV L chain	C, F, I, L	protein	108	Homo sapiens

Sequence of entity 1 (A, D, G, J), FASTA

>6KZ0_1 Genome polyprotein (chains A, D, G, J)
GSGPNTEFALSLLRKNIMTITTSKGEFTGLGIHDRVCVIPTHAQPGDDVLVNGQKIRVKD
KYKLVDPENINLELTVLTLDRNEKFRDIRGFISEDLEGVDATLVVHSNNFTNTILEVGPV
TMAGLINLSSTPTNRMIRYDYATKTGQCGGVLCATGKIFGIHVGGNGRQGFSAQLKKQYF
VEKQ

Sequence of entity 2 (B, E, H, K), FASTA

>6KZ0_2 GGVV H chain (chains B, E, H, K)
GAMMAQVQLVQSGAEVKQPGSSVKVSCKTSGDIFSTYGFNWVRQAPGQGLEWMGGIAPVF
DTLKYAQRFQGRLLITADESATSVYMELSSLRSDDTAVYYCARAGQGGVVGNYLDYWGQG
TLVTVSSGGGGSGGGGSGGGGS

Sequence of entity 3 (C, F, I, L), FASTA

>6KZ0_3 GGVV L chain (chains C, F, I, L)
DIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWYQQKPGKVPKLLIYAASTLQSGVPS
RFSGSGSGTDFTLTISSLQPEDVATYYCQKYNSAPLTFGQGTKVDIKR

Primary citation

Inhibitory antibodies identify unique sites of therapeutic vulnerability in rhinovirus and other enteroviruses. Meng, B., Lan, K., Xie, J. et al. Proc Natl Acad Sci U S A (2020) 117:13499-13508. DOI 10.1073/pnas.1918844117 · PubMed

Other PDB entries of the same protein (UniProt P03303 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KYZ 1.84 Å, HRV14 3C in complex with single chain antibody YDF
9LGP 2.11 Å, Crystal structure of the HRV B14 3C protease in complex with AG7404
5W3M 2.26 Å, CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar…
7BG7 2.4 Å, HRV14 in complex with its receptor ICAM-1
1NCQ 2.5 Å, The structure of HRV14 when complexed with pleconaril, an antiviral compound
5W3E 2.53 Å, CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar…
7BG6 2.6 Å, HRV14 native particle solved by cryoEM
31LE 2.64 Å, HRV E1007A mutant
1K5M 2.7 Å, Crystal Structure of a Human Rhinovirus Type 14:Human Immunodeficiency Virus Type 1 V3…
31LF 2.71 Å, HRV virion E2250A mutant
5W3L 2.71 Å, CryoEM structure of rhinovirus B14 in complex with C5 Fab (4 degrees Celsius, molar…
29UB 2.73 Å, HRV B14 virion

Browse structure collections

About this viewer

MolViewer shows 6KZ0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.