9LGP: HRV B14 3C protease

Crystal structure of the HRV B14 3C protease in complex with AG7404. Determined by X-ray diffraction at 2.11 Å resolution. Released 19 Nov 2025.

Method: X-ray diffraction
Resolution: 2.11 Å
Organism: rhinovirus B14
Chains: 4
Atoms: 6,331
Mol. weight: 82.19 kDa
Ligands: XNV
Released: 19 Nov 2025

Explore 9LGP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9LGP contains 25 α-helices and 61 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	4-13	10
β-strand	15-20	6	1
β-strand	23-31	9	1
β-strand	32	1	2
β-strand	34-38	5	1
α-helix	39-41	3
β-strand	46-49	4	1
β-strand	52-63	12	1
β-strand	69-77	9	1
α-helix	81-82	2
β-strand	83	1	2
α-helix	84	1
α-helix	87-89	3
β-strand	90	1	1
β-strand	98-105	8	1
β-strand	108-126	19	1
β-strand	129-137	9	1
β-strand	149-152	4	1
β-strand	155-163	9	1
β-strand	168-172	5	1
α-helix	173	1
α-helix	175-178	4

Chain B: 6 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	4-13	10
β-strand	15-20	6	3
β-strand	23-31	9	3
β-strand	32	1	4
β-strand	34-38	5	3
α-helix	39-41	3
β-strand	46-49	4	3
β-strand	52-63	12	3
β-strand	69-77	9	3
α-helix	82	1
β-strand	83	1	4
α-helix	84	1
α-helix	87-89	3
β-strand	90	1	3
β-strand	98-105	8	3
β-strand	108-126	19	3
β-strand	129-137	9	3
β-strand	149-152	4	3
β-strand	155-163	9	3
β-strand	168-172	5	3
α-helix	175-177	3

Chain C: 5 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	4-13	10
β-strand	15-20	6	5
β-strand	23-31	9	5
β-strand	32	1	6
β-strand	34-38	5	5
α-helix	39-41	3
β-strand	46-49	4	5
β-strand	52-63	12	5
β-strand	69-77	9	5
β-strand	83	1	6
α-helix	87-89	3
β-strand	90	1	5
β-strand	99-105	7	5
β-strand	108-116	9	5
β-strand	118-126	9	5
β-strand	129-137	9	5
β-strand	149-152	4	5
β-strand	155-163	9	5
β-strand	168-172	5	5
α-helix	173	1
α-helix	175-178	4

Chain D: 7 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	4-13	10
β-strand	15-20	6	7
β-strand	23-31	9	7
β-strand	32	1	8
β-strand	34-38	5	7
α-helix	39-41	3
β-strand	46-49	4	7
β-strand	52-63	12	7
β-strand	69-77	9	7
α-helix	81-82	2
β-strand	83	1	8
α-helix	84-85	2
α-helix	87-89	3
β-strand	90	1	7
β-strand	98-105	8	7
β-strand	108-126	19	7
β-strand	129-137	9	7
β-strand	149-152	4	7
β-strand	155-163	9	7
β-strand	168-172	5	7
α-helix	173	1
α-helix	175-178	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Genome polyprotein	A, B, C, D	protein	182	rhinovirus B14	P03303 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>9LGP_1 Genome polyprotein (chains A, B, C, D)
GPNTEFALSLLRKNIMTITTSKGEFTGLGIHDRVCVIPTHAQPGDDVLVNGQKIRVKDKY
KLVDPENINLELTVLTLDRNEKFRDIRGFISEDLEGVDATLVVHSNNFTNTILEVGPVTM
AGLINLSSTPTNRMIRYDYATKTGQCGGVLCATGKIFGIHVGGNGRQGFSAQLKKQYFVE
KQ

Ligands and cofactors

ID	Name	Formula	Copies
XNV	ethyl (4R)-4-({(2S)-2-[3-{[(5-methyl-1,2-oxazol-3-yl)carbonyl]amino}-2-oxopyrid…	C26 H31 N5 O7	4

Primary citation

Structural insights into the antiviral efficacy of AG7404 against human rhinovirus 3C proteases. Lee, J., Lee, H.L., Kim, H. et al. IUCrJ (2026) 13:19-30. DOI 10.1107/S2052252525008929 · PubMed

Other PDB entries of the same protein (UniProt P03303 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KYZ 1.84 Å, HRV14 3C in complex with single chain antibody YDF
5W3M 2.26 Å, CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar…
6KZ0 2.4 Å, HRV14 3C in complex with single chain antibody GGVV
7BG7 2.4 Å, HRV14 in complex with its receptor ICAM-1
1NCQ 2.5 Å, The structure of HRV14 when complexed with pleconaril, an antiviral compound
5W3E 2.53 Å, CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar…
7BG6 2.6 Å, HRV14 native particle solved by cryoEM
31LE 2.64 Å, HRV E1007A mutant
1K5M 2.7 Å, Crystal Structure of a Human Rhinovirus Type 14:Human Immunodeficiency Virus Type 1 V3…
31LF 2.71 Å, HRV virion E2250A mutant
5W3L 2.71 Å, CryoEM structure of rhinovirus B14 in complex with C5 Fab (4 degrees Celsius, molar…
29UB 2.73 Å, HRV B14 virion

Browse structure collections

About this viewer

MolViewer shows 9LGP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.