3A37: ATPase GET3

Structural insight into the membrane insertion of tail-anchored proteins by Get3. Determined by X-ray diffraction at 3.0 Å resolution. Released 12 Jan 2010.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 4,925
Mol. weight: 81.97 kDa
Ligands: ZN, ADP
Released: 12 Jan 2010

Explore 3A37 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3A37 contains 28 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	10-14	5
β-strand	20-24	5	1
α-helix	31-45	15
β-strand	51-55	5	1
α-helix	61-66	6
β-strand	75-76	2	1
β-strand	83-87	5	1
α-helix	129-131	3
α-helix	136-155	20
β-strand	162-166	5	1
α-helix	175-178	4
α-helix	179-193	15
α-helix	199-202	4
α-helix	210-230	21
β-strand	236-243	8	1
α-helix	246-261	16
β-strand	266-274	9	1
α-helix	286-305	20
β-strand	310-315	6	1
α-helix	323-335	13
α-helix	344-347	4

Chain B: 15 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	4-6	3
α-helix	10-14	5
β-strand	20-24	5	2
α-helix	31-45	15
β-strand	51-55	5	2
α-helix	61-66	6
β-strand	75-76	2	2
β-strand	83-87	5	2
α-helix	90-106	17
α-helix	129-131	3
α-helix	136-155	20
β-strand	162-166	5	2
α-helix	175-178	4
α-helix	179-189	11
α-helix	212-230	19
β-strand	236-243	8	2
α-helix	246-261	16
β-strand	266-274	9	2
α-helix	277-279	3
α-helix	286-305	20
β-strand	310-315	6	2
α-helix	323-335	13
α-helix	344-347	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ATPase GET3	A, B	protein	362	Saccharomyces cerevisiae	Q12154 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3A37_1 ATPase GET3 (chains A, B)
MDLTVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAH
NLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSRANNNGSDGQGDDLGSL
LQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQDEGETFDTVIFDTAPTGHTLRFLQLP
NTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVC
VCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLD
QIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELEDKELEHHHH
HH

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2

Primary citation

Structural insight into the membrane insertion of tail-anchored proteins by Get3. Yamagata, A., Mimura, H., Sato, Y. et al. Genes Cells (2010) 15:29-41. DOI 10.1111/j.1365-2443.2009.01362.x · PubMed

Other PDB entries of the same protein (UniProt Q12154 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2WOJ 1.99 Å, ADP-AlF4 complex of S. cerevisiae GET3
4XTR 2.05 Å, Structure of Get3 bound to the transmembrane domain of Pep12
3ZS9 2.1 Å, S. cerevisiae Get3-ADP-AlF4- complex with a cytosolic Get2 fragment
3H84 2.3 Å, Crystal structure of GET3
4XVU 2.35 Å, Structure of Get3 bound to the transmembrane domain of Nyv1
4XWO 2.75 Å, Structure of Get3 bound to the transmembrane domain of Sec22
3A36 2.8 Å, Structural insight into the membrane insertion of tail-anchored proteins by Get3
5BW8 2.8 Å, 2.8 A crystal structure of a Get3-Get4-Get5 intermediate complex from S.cerevisiae
3B2E 3.0 Å, Crystal structure of S. cerevisiae Get3 in the open conformation in complex with Get1…
3SJA 3.0 Å, Crystal structure of S. cerevisiae Get3 in the open state in complex with Get1 cytosolic…
3ZS8 3.0 Å, S. cerevisiae Get3 complexed with a cytosolic Get1 fragment
9NS5 3.19 Å, Get3(D57N)-Get4/5 Complex (ATP-bound)

Browse structure collections

About this viewer

MolViewer shows 3A37 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.