3H84: GET3

Crystal structure of GET3. Determined by X-ray diffraction at 2.3 Å resolution. Released 22 Dec 2009.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 5,405
Mol. weight: 79.04 kDa
Ligands: ZN, MG
Released: 22 Dec 2009

Explore 3H84 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3H84 contains 31 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	10-13	4
β-strand	20-24	5	1
α-helix	31-45	15
β-strand	51-55	5	1
α-helix	61-66	6
β-strand	75-76	2	1
α-helix	77	1
β-strand	83-87	5	1
α-helix	90-106	17
α-helix	117-120	4
α-helix	122-124	3
α-helix	127-129	3
α-helix	136-152	17
β-strand	162-166	5	1
α-helix	175-178	4
α-helix	179-189	11
α-helix	212-230	19
β-strand	236-243	8	1
α-helix	246-261	16
β-strand	266-274	9	1
α-helix	286-305	20
β-strand	310-315	6	1
α-helix	323-331	9
α-helix	332-334	3
α-helix	340-349	10

Chain B: 14 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	10-13	4
β-strand	20-24	5	2
α-helix	31-45	15
β-strand	51-55	5	2
α-helix	61-66	6
β-strand	75-76	2	2
α-helix	77	1
β-strand	83-87	5	2
α-helix	119-132	14
α-helix	136-154	19
β-strand	162-166	5	2
α-helix	175-178	4
α-helix	179-194	16
α-helix	200-205	6
α-helix	213-230	18
β-strand	236-243	8	2
α-helix	246-261	16
β-strand	268-274	7	2
α-helix	286-305	20
β-strand	310-315	6	2
α-helix	324-335	12
α-helix	340-347	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ATPase GET3	A, B	protein	354	Saccharomyces cerevisiae	Q12154 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3H84_1 ATPase GET3 (chains A, B)
MDLTVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAH
NLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSRANNNGSDGQGDDLGSL
LQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLP
NTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVC
VCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLD
QIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELEDKE

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1
MG	Magnesium ion	Mg	2

Water and common crystallization additives (NA, CL) are not listed.

Primary citation

The crystal structures of yeast Get3 suggest a mechanism for tail-anchored protein membrane insertion. Hu, J., Li, J., Qian, X. et al. PLoS One (2009) 4:e8061-e8061. DOI 10.1371/journal.pone.0008061 · PubMed

Other PDB entries of the same protein (UniProt Q12154 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2WOJ 1.99 Å, ADP-AlF4 complex of S. cerevisiae GET3
4XTR 2.05 Å, Structure of Get3 bound to the transmembrane domain of Pep12
3ZS9 2.1 Å, S. cerevisiae Get3-ADP-AlF4- complex with a cytosolic Get2 fragment
4XVU 2.35 Å, Structure of Get3 bound to the transmembrane domain of Nyv1
4XWO 2.75 Å, Structure of Get3 bound to the transmembrane domain of Sec22
3A36 2.8 Å, Structural insight into the membrane insertion of tail-anchored proteins by Get3
5BW8 2.8 Å, 2.8 A crystal structure of a Get3-Get4-Get5 intermediate complex from S.cerevisiae
3A37 3.0 Å, Structural insight into the membrane insertion of tail-anchored proteins by Get3
3B2E 3.0 Å, Crystal structure of S. cerevisiae Get3 in the open conformation in complex with Get1…
3SJA 3.0 Å, Crystal structure of S. cerevisiae Get3 in the open state in complex with Get1 cytosolic…
3ZS8 3.0 Å, S. cerevisiae Get3 complexed with a cytosolic Get1 fragment
9NS5 3.19 Å, Get3(D57N)-Get4/5 Complex (ATP-bound)

Browse structure collections

About this viewer

MolViewer shows 3H84 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.