3AYU: MMP-2 active site mutant

Crystal structure of MMP-2 active site mutant in complex with APP-drived decapeptide inhibitor. Determined by X-ray diffraction at 2.0 Å resolution. Released 3 Aug 2011.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,660
Mol. weight: 20.03 kDa
Ligands: CA, ZN
Released: 3 Aug 2011

Explore 3AYU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3AYU contains 4 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	1
β-strand	14-19	6	2
α-helix	28-43	16
β-strand	49-52	4	2
β-strand	60-65	6	2
β-strand	83-86	4	2
α-helix	87	1
β-strand	96-99	4	2
β-strand	104-105	2	3
β-strand	112-113	2	3
α-helix	114-125	12
β-strand	128-129	2	1
β-strand	141	1	4
α-helix	152-162	11

Chain B: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	4
β-strand	7-8	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
72 kDa type IV collagenase	A	protein	167	Homo sapiens	P08253 (AlphaFold model)
Amyloid beta A4 protein	B	protein	10	Homo sapiens	P05067 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3AYU_1 72 kDa type IV collagenase (chains A)
YNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADI
MINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGKGVGYSLFLVAAH
AFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPD

Sequence of entity 2 (B), FASTA

>3AYU_2 Amyloid beta A4 protein (chains B)
ISYGNDALMP

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	3
ZN	Zinc ion	Zn	2

Primary citation

Structural basis for matrix metalloproteinase-2 (MMP-2)-selective inhibitory action of {beta}-amyloid precursor protein-derived inhibitor. Hashimoto, H., Takeuchi, T., Komatsu, K. et al. J Biol Chem (2011). DOI 10.1074/jbc.M111.264176 · PubMed

Other PDB entries of the same protein (UniProt P08253 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7XJO 2.0 Å, Crystal structure of human MMP-2 catalytic domain in complex with inhibitor
1GEN 2.15 Å, C-terminal domain of gelatinase a
8H78 2.4 Å, Crystal structure of human MMP-2 catalytic domain in complex with inhibitor
1RTG 2.6 Å, C-terminal domain (haemopexin-like domain) of human matrix metalloproteinase-2
1EAK 2.66 Å, Catalytic domain of proMMP-2 E404Q mutant
1CK7 2.8 Å, Gelatinase a (full-length)
1QIB 2.8 Å, Crystal structure of gelatinase a catalytic domain
7XGJ 2.8 Å, Crystal structure of human MMP-2 catalytic domain in complex with inhibitor
1GXD 3.1 Å, proMMP-2/TIMP-2 complex
1CXW The second type II module from human matrix metalloproteinase 2
1HOV Solution structure of a catalytic domain of mmp-2 complexed with sc-74020
1J7M The Third Fibronectin Type II Module from Human Matrix Metalloproteinase 2

Browse structure collections

About this viewer

MolViewer shows 3AYU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.