Crystal structure of Human Brain-type Creatine Kinase. Determined by X-ray diffraction at 2.0 Å resolution. Released 4 Nov 2008.
Explore 3B6R in 3D Show helices and sheets RCSB PDB PDBe
3B6R contains 40 α-helices and 37 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7-11 | 5 | |
| α-helix | 16-19 | 4 | |
| β-strand | 27 | 1 | 1 |
| β-strand | 28 | 1 | 2 |
| α-helix | 29-33 | 5 | |
| α-helix | 36-42 | 7 | |
| β-strand | 46 | 1 | 3 |
| β-strand | 52 | 1 | 3 |
| α-helix | 53-62 | 10 | |
| β-strand | 65 | 1 | 1 |
| β-strand | 71 | 1 | 2 |
| α-helix | 81-84 | 4 | |
| α-helix | 86-96 | 11 | |
| α-helix | 112-114 | 3 | |
| β-strand | 126-135 | 10 | 4 |
| β-strand | 137 | 1 | 5 |
| α-helix | 148-162 | 15 | |
| α-helix | 167-169 | 3 | |
| β-strand | 171-175 | 5 | 4 |
| α-helix | 181-189 | 9 | |
| α-helix | 200-203 | 4 | |
| β-strand | 216-220 | 5 | 4 |
| β-strand | 225-229 | 5 | 4 |
| β-strand | 235-242 | 8 | 4 |
| α-helix | 246-266 | 21 | |
| β-strand | 271 | 1 | 5 |
| β-strand | 273-274 | 2 | 6 |
| β-strand | 278-279 | 2 | 6 |
| α-helix | 284-286 | 3 | |
| β-strand | 288 | 1 | 6 |
| β-strand | 292-298 | 7 | 4 |
| α-helix | 300-303 | 4 | |
| α-helix | 308-314 | 7 | |
| β-strand | 317-321 | 5 | 4 |
| α-helix | 325-330 | 6 | |
| β-strand | 333-338 | 6 | 4 |
| α-helix | 346-368 | 23 | |
| α-helix | 374-376 | 3 | |
| α-helix | 377-380 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7-11 | 5 | |
| α-helix | 16-19 | 4 | |
| β-strand | 28 | 1 | 7 |
| α-helix | 29-33 | 5 | |
| α-helix | 36-42 | 7 | |
| α-helix | 53-62 | 10 | |
| β-strand | 71 | 1 | 7 |
| α-helix | 81-84 | 4 | |
| α-helix | 86-96 | 11 | |
| α-helix | 112-114 | 3 | |
| β-strand | 126-135 | 10 | 8 |
| β-strand | 137 | 1 | 9 |
| α-helix | 148-162 | 15 | |
| α-helix | 167-169 | 3 | |
| β-strand | 171-175 | 5 | 8 |
| α-helix | 176-178 | 3 | |
| α-helix | 181-189 | 9 | |
| α-helix | 194-196 | 3 | |
| α-helix | 200-204 | 5 | |
| β-strand | 216-220 | 5 | 8 |
| β-strand | 225-229 | 5 | 8 |
| β-strand | 235-242 | 8 | 8 |
| α-helix | 246-266 | 21 | |
| β-strand | 271 | 1 | 9 |
| β-strand | 273-274 | 2 | 10 |
| β-strand | 278-279 | 2 | 10 |
| α-helix | 284-286 | 3 | |
| β-strand | 288 | 1 | 10 |
| β-strand | 292-298 | 7 | 8 |
| α-helix | 300-303 | 4 | |
| α-helix | 308-314 | 7 | |
| β-strand | 317-320 | 4 | 8 |
| β-strand | 321 | 1 | 11 |
| β-strand | 324 | 1 | 11 |
| β-strand | 330 | 1 | 8 |
| β-strand | 333-338 | 6 | 8 |
| α-helix | 346-367 | 22 | |
| α-helix | 378-380 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Creatine kinase B-type | A, B | protein | 381 | Homo sapiens | P12277 (AlphaFold model) |
>3B6R_1 Creatine kinase B-type (chains A, B) MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTG VDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDD LDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMT EAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISM QKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLP NLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLL IEMEQRLEQGQAIDDLMPAQK
| ID | Name | Formula | Copies |
|---|---|---|---|
| CRN | N-[(E)-amino(imino)methyl]-N-methylglycine | C4 H9 N3 O2 | 1 |
| ADP | Adenosine-5'-diphosphate | C10 H15 N5 O10 P2 | 1 |
| MG | Magnesium ion | Mg | 1 |
Water and common crystallization additives (NO3, ACT) are not listed.
Structural studies of human brain-type creatine kinase complexed with the ADP-Mg2+-NO3- -creatine transition-state analogue complex. Bong, S.M., Moon, J.H., Nam, K.H. et al. FEBS Lett (2008) 582:3959-3965. DOI 10.1016/j.febslet.2008.10.039 · PubMed
Other PDB entries of the same protein (UniProt P12277 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3B6R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.