Crystal structure of the 3rd PDZ domain of human membrane associated guanylate kinase, C677S and C709S double mutant. Determined by X-ray diffraction at 1.6 Å resolution. Released 8 Jan 2008.
Explore 3BPU in 3D Show helices and sheets RCSB PDB PDBe
3BPU contains 2 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 639-647 | 9 | 1 |
| β-strand | 649 | 1 | 2 |
| β-strand | 652 | 1 | 2 |
| β-strand | 656-659 | 4 | 1 |
| β-strand | 666-670 | 5 | 1 |
| β-strand | 685-689 | 5 | 1 |
| β-strand | 692-693 | 2 | 1 |
| α-helix | 699-707 | 9 | |
| α-helix | 710 | 1 | |
| β-strand | 714-722 | 9 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 | A | protein | 88 | Homo sapiens | Q96QZ7 (AlphaFold model) |
>3BPU_1 Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (chains A) SMELITVHIVKGPMGFGFTIADSPGGGGQRVKQIVDSPRSRGLKEGDLIVEVNKKNVQAL THNQVVDMLVESPKGSEVTLLVQRQTRL
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
Crystal structure of the 3rd PDZ domain of human membrane associated guanylate kinase, C677S and C709S double mutant. Pilka, E.S., Hozjan, V., Cooper, C. et al. To be published.
Other PDB entries of the same protein (UniProt Q96QZ7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3BPU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.