3BU6: Insulin receptor kinase

Crystal structure of the insulin receptor kinase in complex with IRS2 KRLB phosphopeptide. Determined by X-ray diffraction at 1.95 Å resolution. Released 19 Feb 2008.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,690
Mol. weight: 36.83 kDa
Released: 19 Feb 2008

Explore 3BU6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3BU6 contains 20 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	990	1	1
α-helix	993-995	3
β-strand	996-1004	9	1
β-strand	1009-1016	8	1
β-strand	1024-1030	7	1
α-helix	1038-1052	15
β-strand	1059	1	2
α-helix	1060-1061	2
β-strand	1062-1066	5	1
β-strand	1073-1077	5	1
β-strand	1083	1	2
α-helix	1084-1090	7
α-helix	1102	1
α-helix	1104-1105	2
α-helix	1106-1125	20
β-strand	1128-1129	2	3
α-helix	1135-1137	3
β-strand	1138-1140	3	2
β-strand	1146-1148	3	2
β-strand	1155-1156	2	3
β-strand	1163-1164	2	4
β-strand	1167-1171	5	5
α-helix	1173-1175	3
α-helix	1178-1183	6
β-strand	1185-1186	2	4
α-helix	1188-1204	17
α-helix	1207-1208	2
α-helix	1215-1223	9
α-helix	1228-1231	4
α-helix	1236-1245	10
α-helix	1250-1252	3
α-helix	1254-1255	2
α-helix	1256-1263	8
α-helix	1271-1274	4

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	625-627	3
β-strand	629-633	5	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
insulin receptor subunit beta	A	protein	306	Homo sapiens	P06213 (AlphaFold model)
Insulin receptor substrate 2	B	protein	15		P81122 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3BU6_1 insulin receptor subunit beta (chains A)
VFPSSVYVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESAS
LRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAEN
NPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDI
YETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQ
VLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPNMRPTFLEIVNLLKDDLHPSFPEVSFF
HSEENK

Sequence of entity 2 (B), FASTA

>3BU6_2 Insulin receptor substrate 2 (chains B)
AYNPYPEDYGDIEIG

Primary citation

Structural and biochemical characterization of the KRLB region in insulin receptor substrate-2. Wu, J., Tseng, Y.D., Xu, C.F. et al. Nat Struct Mol Biol (2008) 15:251-258. DOI 10.1038/nsmb.1388 · PubMed

Other PDB entries of the same protein (UniProt P06213 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3BU3 1.65 Å, Crystal structure of the insulin receptor kinase in complex with IRS2 KRLB peptide
5HHW 1.79 Å, Crystal structure of insulin receptor kinase domain in complex with…
4IBM 1.8 Å, Crystal structure of insulin receptor kinase domain in complex with an inhibitor Irfin-1
5U1M 1.8 Å, Structure of the IRS-1 PTB Domain Bound to the Juxtamembrane Region of the Insulin…
1IR3 1.9 Å, Phosphorylated insulin receptor tyrosine kinase in complex with peptide substrate and…
1P14 1.9 Å, Crystal structure of a catalytic-loop mutant of the insulin receptor tyrosine kinase
1IRK 2.1 Å, Crystal structure of the tyrosine kinase domain of the human insulin receptor
3BU5 2.1 Å, Crystal structure of the insulin receptor kinase in complex with IRS2 KRLB peptide and ATP
3EKK 2.1 Å, Insulin receptor kinase complexed with an inhibitor
8DWN 2.15 Å, Crystal structure of bis-phosphorylated insulin receptor kinase domain
3EKN 2.2 Å, Insulin receptor kinase complexed with an inhibitor
5E1S 2.26 Å, The Crystal structure of INSR Tyrosine Kinase in complex with the Inhibitor BI 885578

Browse structure collections

About this viewer

MolViewer shows 3BU6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.