3C98: Syntaxin-binding protein 1

Revised structure of the munc18a-syntaxin1 complex. Determined by X-ray diffraction at 2.6 Å resolution. Released 25 Mar 2008.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Rattus norvegicus
Chains: 2
Atoms: 6,396
Mol. weight: 101.52 kDa
Released: 25 Mar 2008

Explore 3C98 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3C98 contains 40 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 31 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	6-14	9
α-helix	15-19	5
α-helix	20-22	3
β-strand	24	1	1
β-strand	27	1	1
β-strand	29-33	5	2
α-helix	35-42	8
α-helix	47-50	4
β-strand	55-60	6	2
β-strand	68	1	3
β-strand	73-77	5	2
α-helix	81-89	9
α-helix	94-96	3
β-strand	99	1	3
β-strand	102-106	5	2
α-helix	109-111	3
α-helix	112-119	8
α-helix	122-125	4
β-strand	127-132	6	2
β-strand	138-139	2	4
β-strand	144-146	3	4
α-helix	152-157	6
α-helix	159-161	3
α-helix	166-183	18
β-strand	188-191	4	4
α-helix	196-215	20
β-strand	229-234	6	4
α-helix	235-237	3
β-strand	248	1	5
α-helix	249-256	8
β-strand	260	1	6
β-strand	263-269	7	6
β-strand	274-280	7	6
α-helix	286-291	6
β-strand	295	1	5
α-helix	296-313	18
α-helix	335-337	3
α-helix	338-357	20
α-helix	358-362	5
α-helix	363-374	12
β-strand	376	1	7
β-strand	382	1	7
α-helix	387-394	8
α-helix	401-414	14
β-strand	418	1	8
α-helix	420-430	11
α-helix	434-442	9
α-helix	443-446	4
β-strand	451	1	8
α-helix	460-465	6
α-helix	481-490	10
β-strand	536-542	7	4
β-strand	545-546	2	9
α-helix	547-560	14
β-strand	564-569	6	4
β-strand	572-573	2	9
α-helix	575-582	8

Chain B: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	31-62	32
α-helix	70-104	35
α-helix	111-156	46
α-helix	162-170	9
α-helix	190-210	21
α-helix	213-226	14
α-helix	229-231	3
α-helix	233-238	6
α-helix	240-243	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Syntaxin-binding protein 1	A	protein	606	Rattus norvegicus	P61765 (AlphaFold model)
Syntaxin-1A	B	protein	279	Rattus norvegicus	P32851 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3C98_1 Syntaxin-binding protein 1 (chains A)
MRGSHHHHHHGSMAPIGLKAVVGEKIMHDVIKKVKKKGEWKVLVVDQLSMRMLSSCCKMT
DIMTEGITIVEDINKRREPLPSLEAVYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTD
SCPDALFNELVKSRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPI
LERLAEQIATLCATLKEYPAVRYRGEYKDNALLAQLIQDKLDAYKADDPTMGEGPDKARS
QLLILDRGFDPSSPVLHELTFQAMSYDLLPIENDVYKYETSGIGEARVKEVLLDEDDDLW
IALRHKHIAEVSQEVTRSLKDFSSSKRMNTGEKTTMRDLSQMLKKMPQYQKELSKYSTHL
HLAEDCMKHYQGTVDKLCRVEQDLAMGTDAEGEKIKDPMRAIVPILLDANVSTYDKIRII
LLYIFLKNGITEENLNKLIQHAQIPPEDSEIITNMAHLGVPIVTDSTLRRRSKPERKERI
SEQTYQLSRWTPIIKDIMEDTIEDKLDTKHYPYISTRSSASFSTTAVSARYGHWHKNKAP
GEYRSGPRLIIFILGGVSLNEMRCAYEVTQANGKWEVLIGSTHILTPQKLLDTLKKLNKT
DEEISS

Sequence of entity 2 (B), FASTA

>3C98_2 Syntaxin-1A (chains B)
MRGSHHHHHHGSMKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIA
ENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNR
SSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDM
LESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGE
MIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIM

Primary citation

Munc18a controls SNARE assembly through its interaction with the syntaxin N-peptide. Burkhardt, P., Hattendorf, D.A., Weis, W.I. et al. EMBO J (2008) 27:923-933. DOI 10.1038/emboj.2008.37 · PubMed

Other PDB entries of the same protein (UniProt P61765 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JEH 2.5 Å, Crystal Structure of Munc18a and Syntaxin1 lacking N-peptide complex
4JEU 3.2 Å, Crystal Structure of Munc18a and Syntaxin1 with native N-terminus complex
7XSJ 3.2 Å, The structure of the Mint1/Munc18-1/syntaxin-1 complex
3PUJ 3.31 Å, Crystal structure of the MUNC18-1 and SYNTAXIN4 N-Peptide complex
6LPC 3.4 Å, Crystal Structure of rat Munc18-1 with K332E/K333E mutation
7UDB 3.5 Å, Cryo-EM structure of a synaptobrevin-Munc18-1-syntaxin-1 complex class 2
7UDC 3.7 Å, cryo-EM structures of a synaptobrevin-Munc18-1-syntaxin-1 complex class1

Browse structure collections

About this viewer

MolViewer shows 3C98 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.