3CNQ: Subtilisin BPN'

Prosubtilisin Substrate Complex of Subtilisin SUBT_BACAM. Determined by X-ray diffraction at 1.71 Å resolution. Released 6 May 2008.

Method: X-ray diffraction
Resolution: 1.71 Å
Organism: Bacillus amyloliquefaciens
Chains: 2
Atoms: 2,665
Mol. weight: 35.53 kDa
Ligands: ZN
Released: 6 May 2008

Explore 3CNQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3CNQ contains 14 α-helices and 21 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain P: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	11-16	6	1
α-helix	23-31	9
β-strand	36-40	5	1
β-strand	46-50	5	1
α-helix	53-60	8
β-strand	65-70	6	1
β-strand	73-76	4	2

Chain S: 12 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	7-10	4
α-helix	13-18	6
β-strand	27-32	6	3
β-strand	46-49	4	3
α-helix	64-84	12
β-strand	89-94	6	3
β-strand	101-103	3	2
α-helix	104-116	13
β-strand	121-124	4	3
β-strand	126-127	2	2
β-strand	128	1	4
α-helix	133-144	12
β-strand	148-152	5	3
α-helix	165-166	2
β-strand	167	1	4
β-strand	175-180	6	3
α-helix	185	1
β-strand	186	1	3
α-helix	187	1
β-strand	198-201	4	3
β-strand	205-209	5	5
β-strand	213-217	5	5
α-helix	220-237	18
α-helix	243-252	10
β-strand	255	1	3
α-helix	260-263	4
β-strand	267	1	3
α-helix	270-273	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Subtilisin BPN'	P	protein	80	Bacillus amyloliquefaciens	P00782 (AlphaFold model)
Subtilisin BPN'	S	protein	266	Bacillus amyloliquefaciens	P00782 (AlphaFold model)

Sequence of entity 1 (P), FASTA

>3CNQ_1 Subtilisin BPN' (chains P)
MGGKSNGEKKYIVGFKQGFKSCAKKEDVISEKGGKLQKCFKYVDAASATLNEKAVEELKK
DPSVAYVEEDKLYRALSATS

Sequence of entity 2 (S), FASTA

>3CNQ_2 Subtilisin BPN' (chains S)
AKCVSYGVAQIKAPALHSQGYTGSNVKVAVLASGIDSSHPDLNVAGGASFVPSETNPFQD
NNSHGTHVAGTVLAVAPSASLYAVKVLGADGSGQASWIINGIEWAIANNMDVINMSLGSP
SGSAALKAAVDKAVASGVVVVAAAGNSGTSGSSSTVSYPAKYPSVIAVGAVDSSNQRAPF
SSVGPELDVMAPGVSICSTLPGGKYGALSGTAMASPHVAGAAALILSKHPNWTNTQVRSS
LENTATKLGDSFYYGKGLINVEAAAQ

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	5

Primary citation

Engineering substrate preference in subtilisin: structural and kinetic analysis of a specificity mutant. Ruan, B., London, V., Fisher, K.E. et al. Biochemistry (2008) 47:6628-6636. DOI 10.1021/bi800089f · PubMed

Other PDB entries of the same protein (UniProt P00782 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1TO2 1.3 Å, crystal structure of the complex of subtilisin BPN' with chymotrypsin inhibitor 2 M59K,…
1TM5 1.45 Å, crystal structure of the complex of subtilisin BPN' with chymotrypsin inhibitor 2 M59A…
1LW6 1.5 Å, Crystal Structure of the Complex of Subtilisin BPN' with Chymotrypsin Inhibitor 2 at 1.5…
1V5I 1.5 Å, Crystal structure of serine protease inhibitor POIA1 in complex with subtilisin BPN'
1Y34 1.55 Å, Crystal structure of the complex of subtilisin BPN' with chymotrypsin inhibitor 2 E60A…
8H7O 1.55 Å, Crystal structure of aqualigase
1Y1K 1.56 Å, Crystal structure of the complex of subtilisin BPN' with chymotrypsin inhibitor 2 T58A…
1TM3 1.57 Å, crystal structure of the complex of subtilisin BPN' with chymotrypsin inhibitor 2 M59k…
1TM7 1.59 Å, crystal structure of the complex of subtilisin BPN' with chymotrypsin inhibitor 2 M59Y…
1SUP 1.6 Å, Subtilisin bpn' at 1.6 Å resolution: analysis of discrete disorder and comparison of…
1Y4A 1.6 Å, Crystal structure of the complex of subtilisin BPN' with chymotrypsin inhibitor 2…
7AM3 1.61 Å, Crystal structure of Peptiligase mutant - M222P

Browse structure collections

About this viewer

MolViewer shows 3CNQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.