3COA: FoxO1 DBD

Crystal Structure of FoxO1 DBD Bound to IRE DNA. Determined by X-ray diffraction at 2.2 Å resolution. Released 16 Sept 2008.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 6
Atoms: 2,887
Mol. weight: 45.98 kDa
Ligands: CA
Released: 16 Sept 2008

Explore 3COA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3COA contains 11 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	158	1	1
β-strand	161	1	1
α-helix	165-174	10
β-strand	181	1	2
α-helix	183-193	11
α-helix	195-197	3
α-helix	203-219	17
β-strand	223-226	4	2
α-helix	227-228	2
α-helix	233-235	3
β-strand	236-239	4	2

Chain F: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	158	1	3
β-strand	161	1	3
α-helix	165-175	11
β-strand	181	1	4
α-helix	183-193	11
α-helix	195-197	3
α-helix	203-219	17
β-strand	223-226	4	4
α-helix	233-235	3
β-strand	236-239	4	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(dtpdgpdgpdtpdtpdtpdgpdtpdtpdtpdtpdgpdcpdtpdtpdg)-3')	A, D	DNA	16
DNA (5'-d(dcpdapdapdgpdcpdapdapdapdapdcpdapdapdapdcpdcpda)-3')	B, E	DNA	16
Forkhead box protein O1	C, F	protein	117	Homo sapiens	Q12778 (AlphaFold model)

Sequence of entity 1 (A, D), FASTA

>3COA_1 DNA (5'-D(*DTP*DGP*DGP*DTP*DTP*DTP*DGP*DTP*DTP*DTP*DTP*DGP*DCP*DTP*DTP*DG)-3') (chains A, D)
TGGTTTGTTTTGCTTG

Sequence of entity 2 (B, E), FASTA

>3COA_2 DNA (5'-D(*DCP*DAP*DAP*DGP*DCP*DAP*DAP*DAP*DAP*DCP*DAP*DAP*DAP*DCP*DCP*DA)-3') (chains B, E)
CAAGCAAAACAAACCA

Sequence of entity 3 (C, F), FASTA

>3COA_3 Forkhead box protein O1 (chains C, F)
SKSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGW
KNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKS

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Primary citation

Structural Basis for DNA Recognition by FoxO1 and Its Regulation by Posttranslational Modification. Brent, M.M., Anand, R., Marmorstein, R. Structure (2008) 16:1407-1416. DOI 10.1016/j.str.2008.06.013 · PubMed

Other PDB entries of the same protein (UniProt Q12778 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8A62 1.6 Å, Small molecule stabilizer (compound 2) for FOXO1 and 14-3-3
8A65 1.6 Å, Small molecule stabilizer (compound 3) for FOXO1 and 14-3-3
6QZS 1.9 Å, 14-3-3 sigma in complex with FOXO1 pS256 peptide
3CO6 2.1 Å, Crystal Structure of FoxO1 DBD Bound to DBE1 DNA
4LG0 2.19 Å, Structure of a ternary FOXO1-ETS1 DNA complex
6QZR 2.3 Å, 14-3-3 sigma in complex with FOXO1 pT24 peptide
5DUI 2.31 Å, Identification of a new FoxO1 binding site that precludes CREB binding at the…
3CO7 2.91 Å, Crystal Structure of FoxO1 DBD Bound to DBE2 DNA
6LBI 3.07 Å, Crystal Structure of FOXO1-DBD homodimer bound to a palindromic DNA sequence
6QVW Solution structure of the free FOXO1 DNA binding domain

Browse structure collections

About this viewer

MolViewer shows 3COA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.