6LBI: FOXO1-DBD homodimer

Crystal Structure of FOXO1-DBD homodimer bound to a palindromic DNA sequence. Determined by X-ray diffraction at 3.07 Å resolution. Released 10 Feb 2021.

Method: X-ray diffraction
Resolution: 3.07 Å
Organism: Homo sapiens
Chains: 12
Atoms: 6,172
Mol. weight: 116.12 kDa
Released: 10 Feb 2021

Explore 6LBI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6LBI contains 29 α-helices and 23 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	165-174	10
β-strand	181	1	1
α-helix	183-193	11
α-helix	195-197	3
α-helix	207-219	13
β-strand	223-226	4	1
α-helix	233-235	3
β-strand	236-239	4	1

Chain D: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	165-175	11
β-strand	181	1	2
α-helix	183-193	11
α-helix	195-197	3
α-helix	209-219	11
β-strand	223-226	4	2
α-helix	233-235	3
β-strand	236-239	4	2

Chain G: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	165-175	11
β-strand	181	1	3
α-helix	183-193	11
α-helix	195-198	4
α-helix	207-219	13
β-strand	223-226	4	3
α-helix	234-235	2
β-strand	236-239	4	3

Chain H: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	165-175	11
β-strand	181	1	4
α-helix	183-193	11
α-helix	195-197	3
α-helix	209-219	11
β-strand	223	1	5
β-strand	226	1	6
α-helix	234-235	2
β-strand	236	1	6
β-strand	237	1	4
β-strand	239	1	5

Chain K: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	165-175	11
β-strand	180-181	2	7
α-helix	183-193	11
α-helix	195-197	3
α-helix	208-219	12
β-strand	223-226	4	7
α-helix	234-235	2
β-strand	236-239	4	7

Chain L: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	158	1	8
β-strand	161	1	8
α-helix	165-175	11
β-strand	181-182	2	9
α-helix	183-193	11
α-helix	195-197	3
α-helix	207-219	13
β-strand	223-226	4	9
β-strand	236-239	4	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
IRE0	A, B, E, F, I, J	DNA	20	Homo sapiens
Forkhead box protein O1	C, D, G, H, K, L	protein	118	Homo sapiens	Q12778 (AlphaFold model)

Sequence of entity 1 (A, B, E, F, I, J), FASTA

>6LBI_1 IRE0 (chains A, B, E, F, I, J)
ACCGTAAACATGTTTACGGT

Sequence of entity 2 (C, D, G, H, K, L), FASTA

>6LBI_2 Forkhead box protein O1 (chains C, D, G, H, K, L)
GPSKSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSA
GWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAK

Primary citation

Mechanism of forkhead transcription factors binding to a novel palindromic DNA site. Li, J., Dai, S., Chen, X. et al. Nucleic Acids Res (2021) 49:3573-3583. DOI 10.1093/nar/gkab086 · PubMed

Other PDB entries of the same protein (UniProt Q12778 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8A62 1.6 Å, Small molecule stabilizer (compound 2) for FOXO1 and 14-3-3
8A65 1.6 Å, Small molecule stabilizer (compound 3) for FOXO1 and 14-3-3
6QZS 1.9 Å, 14-3-3 sigma in complex with FOXO1 pS256 peptide
3CO6 2.1 Å, Crystal Structure of FoxO1 DBD Bound to DBE1 DNA
4LG0 2.19 Å, Structure of a ternary FOXO1-ETS1 DNA complex
3COA 2.2 Å, Crystal Structure of FoxO1 DBD Bound to IRE DNA
6QZR 2.3 Å, 14-3-3 sigma in complex with FOXO1 pT24 peptide
5DUI 2.31 Å, Identification of a new FoxO1 binding site that precludes CREB binding at the…
3CO7 2.91 Å, Crystal Structure of FoxO1 DBD Bound to DBE2 DNA
6QVW Solution structure of the free FOXO1 DNA binding domain

Browse structure collections

About this viewer

MolViewer shows 6LBI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.