4LG0: Ternary FOXO1-ETS1 DNA complex

Structure of a ternary FOXO1-ETS1 DNA complex. Determined by X-ray diffraction at 2.19 Å resolution. Released 2 Jul 2014.

Method: X-ray diffraction
Resolution: 2.19 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,618
Mol. weight: 41.08 kDa
Ligands: CA
Released: 2 Jul 2014

Explore 4LG0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4LG0 contains 12 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	158	1	1
β-strand	161	1	1
α-helix	165-174	10
β-strand	181	1	2
α-helix	183-193	11
α-helix	195-199	5
α-helix	207-219	13
β-strand	223-226	4	2
α-helix	235	1
β-strand	236-239	4	2

Chain B: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	334-336	3
α-helix	337-345	9
α-helix	348-350	3
β-strand	355-356	2	3
β-strand	362-364	3	3
α-helix	368-379	12
α-helix	386-395	10
β-strand	402-404	3	3
β-strand	411-414	4	3
α-helix	418-422	5
α-helix	426-432	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Forkhead box protein O1	A	protein	133	Homo sapiens	Q12778 (AlphaFold model)
Protein C-ets-1	B	protein	112	Homo sapiens	P14921 (AlphaFold model)
DNA (5'-d(dtpdtpdcpdapdcpdgpdgpdtpdtpdtpdcpdcpdtpdgpdtpdtpdapdtpdtpdgp*dt)-3')	C	DNA	21
DNA (5'-d(dapdapdapdcpdapdapdtpdapdapdcpdapdgpdgpdapdapdapdcpdcpdgpdtp*dg)-3')	D	DNA	21

Sequence of entity 1 (A), FASTA

>4LG0_1 Forkhead box protein O1 (chains A)
GPGYPGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYF
KDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASM
DNNSKFAKSRSRA

Sequence of entity 2 (B), FASTA

>4LG0_2 Protein C-ets-1 (chains B)
MGGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEK
LSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDAD

Sequence of entity 3 (C), FASTA

>4LG0_3 DNA (5'-D(*DTP*DTP*DCP*DAP*DCP*DGP*DGP*DTP*DTP*DTP*DCP*DCP*DTP*DGP*DTP*DTP*DAP*DTP*DTP*DGP*DT)-3') (chains C)
TTCACGGTTTCCTGTTATTGT

Sequence of entity 4 (D), FASTA

>4LG0_4 DNA (5'-D(*DAP*DAP*DAP*DCP*DAP*DAP*DTP*DAP*DAP*DCP*DAP*DGP*DGP*DAP*DAP*DAP*DCP*DCP*DGP*DTP*DG)-3') (chains D)
AAACAATAACAGGAAACCGTG

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Water and common crystallization additives (PG4) are not listed.

Primary citation

Structure of a ternary FOXO1-ETS1 DNA complex. Birrane, G., Choy, W.C., Datta, D. et al. To be published.

Other PDB entries of the same protein (UniProt Q12778 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8A62 1.6 Å, Small molecule stabilizer (compound 2) for FOXO1 and 14-3-3
8A65 1.6 Å, Small molecule stabilizer (compound 3) for FOXO1 and 14-3-3
6QZS 1.9 Å, 14-3-3 sigma in complex with FOXO1 pS256 peptide
3CO6 2.1 Å, Crystal Structure of FoxO1 DBD Bound to DBE1 DNA
3COA 2.2 Å, Crystal Structure of FoxO1 DBD Bound to IRE DNA
6QZR 2.3 Å, 14-3-3 sigma in complex with FOXO1 pT24 peptide
5DUI 2.31 Å, Identification of a new FoxO1 binding site that precludes CREB binding at the…
3CO7 2.91 Å, Crystal Structure of FoxO1 DBD Bound to DBE2 DNA
6LBI 3.07 Å, Crystal Structure of FOXO1-DBD homodimer bound to a palindromic DNA sequence
6QVW Solution structure of the free FOXO1 DNA binding domain

Browse structure collections

About this viewer

MolViewer shows 4LG0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.