3CXB: Sifa and skip

Crystal Structure of sifa and skip. Determined by X-ray diffraction at 2.6 Å resolution. Released 2 Dec 2008.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Salmonella typhimurium, Homo sapiens
Chains: 2
Atoms: 3,335
Mol. weight: 50.92 kDa
Released: 2 Dec 2008

Explore 3CXB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3CXB contains 15 α-helices and 17 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	25-34	10
α-helix	35-37	3
β-strand	38	1	1
α-helix	42-54	13
α-helix	59-61	3
α-helix	62-75	14
β-strand	76	1	1
α-helix	78-81	4
β-strand	84-87	4	2
α-helix	89-91	3
β-strand	96-101	6	2
β-strand	108-114	7	2
β-strand	118-123	6	2
β-strand	126-132	7	2
β-strand	145-153	9	3
β-strand	158-167	10	3
α-helix	172-173	2
β-strand	174-177	4	3
α-helix	180-187	8
α-helix	197-220	24
α-helix	228-241	14
α-helix	258-267	10
α-helix	283-303	21
α-helix	307-324	18

Chain B: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	775-781	7	2
β-strand	794-801	8	2
β-strand	804-808	5	2
β-strand	818-821	4	2
β-strand	827-832	6	2
β-strand	841-846	6	2
β-strand	852-855	4	2
α-helix	859-873	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein sifA	A	protein	336	Salmonella typhimurium	Q56061 (AlphaFold model)
Pleckstrin homology domain-containing family M member 2	B	protein	112	Homo sapiens	Q8IWE5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3CXB_1 Protein sifA (chains A)
MPITIGNGFLKSEILTNSPRNTKEAWWKVLWEKIKDFFFSTGKAKADRCLHEMLFAERAP
TRERLTEIFFELKELACASQRDRFQVHNPHENDATIILRIMDQNEENELLRITQNTDTFS
CEVMGNLYFLMKDRPDILKSHPQMTAMIKRRYSEIVDYPLPSTLCLNPAGAPILSVPLDN
IEGYLYTELRKGHLDGWKAQEKATYLAAKIQSGIEKTTRILHHANISESTQQNAFLETMA
MCGLKQLEIPPPHTHIPIEKMVKEVLLADKTFQAFLVTDPSTSQSMLAEIVEAISDQVFH
AIFRIDPQAIQKMAEEQLTTLHVRSEQQSGCLCCFL

Sequence of entity 2 (B), FASTA

>3CXB_2 Pleckstrin homology domain-containing family M member 2 (chains B)
TKEGMLHYKAGTSYLGKEHWKTCFVVLSNGILYQYPDRTDVIPLLSVNMGGEQCGGCRRA
NTTDRPHAFQVILSDRPCLELSAESEAEMAEWMQHLCQAVSKGVIPQGVAPS

Primary citation

Structure and function of Salmonella SifA indicate that its interactions with SKIP, SseJ, and RhoA family GTPases induce endosomal tubulation. Ohlson, M.B., Huang, Z., Alto, N.M. et al. Cell Host Microbe (2008) 4:434-446. DOI 10.1016/j.chom.2008.08.012 · PubMed

Other PDB entries of the same protein (UniProt Q56061 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3HW2 3.3 Å, Crystal structure of the SifA-SKIP(PH) complex

Browse structure collections

About this viewer

MolViewer shows 3CXB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.