3HW2: SifA-SKIP(PH) complex

Crystal structure of the SifA-SKIP(PH) complex. Determined by X-ray diffraction at 3.3 Å resolution. Released 3 Nov 2009.

Method: X-ray diffraction
Resolution: 3.3 Å
Organisms: Salmonella enterica subsp. enterica serovar Typhimurium, Homo sapiens
Chains: 2
Atoms: 3,297
Mol. weight: 50.28 kDa
Released: 3 Nov 2009

Explore 3HW2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3HW2 contains 15 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	25-32	8
α-helix	40-54	15
α-helix	59-61	3
α-helix	62-75	14
α-helix	78-81	4
β-strand	84-87	4	1
α-helix	89-91	3
β-strand	96-101	6	1
β-strand	108-114	7	1
β-strand	118-123	6	1
β-strand	126-132	7	1
β-strand	145-153	9	2
β-strand	158-167	10	2
β-strand	174-177	4	2
α-helix	179-189	11
α-helix	195-220	26
α-helix	228-242	15
α-helix	258-267	10
α-helix	273-276	4
α-helix	284-303	20
α-helix	307-322	16
α-helix	323-326	4

Chain B: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	773-781	9	1
β-strand	794-801	8	1
β-strand	804-808	5	1
β-strand	818-821	4	1
β-strand	827-832	6	1
β-strand	840-846	7	1
β-strand	851-856	6	1
α-helix	859-873	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein sifA	A	protein	336	Salmonella enterica subsp. enterica serovar Typhimurium	Q56061 (AlphaFold model)
Pleckstrin homology domain-containing family M member 2	B	protein	105	Homo sapiens	Q8IWE5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3HW2_1 Protein sifA (chains A)
MPITIGNGFLKSEILTNSPRNTKEAWWKVLWEKIKDFFFSTGKAKADRCLHEMLFAERAP
TRERLTEIFFELKELACASQRDRFQVHNPHENDATIILRIMDQNEENELLRITQNTDTFS
CEVMGNLYFLMKDRPDILKSHPQMTAMIKRRYSEIVDYPLPSTLCLNPAGAPILSVPLDN
IEGYLYTELRKGHLDGWKAQEKATYLAAKIQSGIEKTTRILHHANISESTQQNAFLETMA
MCGLKQLEIPPPHTHIPIEKMVKEVLLADKTFQAFLVTDPSTSQSMLAEIVEAISDQVFH
AIFRIDPQAIQKMAEEQLTTLHVRSEQQSGCLCCFL

Sequence of entity 2 (B), FASTA

>3HW2_2 Pleckstrin homology domain-containing family M member 2 (chains B)
TITKEGMLHYKAGTSYLGKEHWKTCFVVLSNGILYQYPDRTDVIPLLSVNMGGEQCGGCR
RANTTDRPHAFQVILSDRPCLELSAESEAEMAEWMQHLCQAVSKG

Primary citation

Interaction between the SifA virulence factor and its host target skip is essential for salmonella pathogenesis. Diacovich, L., Dumont, A., Lafitte, D. et al. J Biol Chem (2009) 284:33151-33160. DOI 10.1074/jbc.M109.034975 · PubMed

Other PDB entries of the same protein (UniProt Q56061 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CXB 2.6 Å, Crystal Structure of sifa and skip

Browse structure collections

About this viewer

MolViewer shows 3HW2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.