Crystal Structure of Human Sulfiredoxin (Srx) in Complex with ATP:Mg2+. Determined by X-ray diffraction at 1.8 Å resolution. Released 1 Jul 2008.
Explore 3CYI in 3D Show helices and sheets RCSB PDB PDBe
3CYI contains 7 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 39-45 | 7 | 1 |
| α-helix | 46-48 | 3 | |
| β-strand | 49-50 | 2 | 1 |
| α-helix | 59-71 | 13 | |
| α-helix | 73-75 | 3 | |
| α-helix | 77-78 | 2 | |
| β-strand | 79-85 | 7 | 1 |
| β-strand | 91-94 | 4 | 1 |
| α-helix | 99-107 | 9 | |
| β-strand | 112-120 | 9 | 1 |
| α-helix | 122-129 | 8 | |
| α-helix | 130-132 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sulfiredoxin-1 | A | protein | 110 | Homo sapiens | Q9BYN0 (AlphaFold model) |
>3CYI_1 Sulfiredoxin-1 (chains A) GPHMSIHSGRIAAVHNVPLSVLIRPLPSVLDPAKVQSLVDTIREDPDSVPPIDVLWIKGA QGGDYFYSFGGSHRYAAYQQLQRETIPAKLVQSTLSDLRVYLGASTPDLQ
Reduction of Cysteine Sulfinic Acid in Peroxiredoxin by Sulfiredoxin Proceeds Directly through a Sulfinic Phosphoryl Ester Intermediate. Jonsson, T.J., Murray, M.S., Johnson, L.C. et al. J Biol Chem (2008) 283:23846-23851. DOI 10.1074/jbc.M803244200 · PubMed
Other PDB entries of the same protein (UniProt Q9BYN0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3CYI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.