3D4S: Beta-2 adrenergic receptor/T4-lysozyme chimera

Cholesterol bound form of human beta2 adrenergic receptor. Determined by X-ray diffraction at 2.8 Å resolution. Released 17 Jun 2008.

Method: X-ray diffraction
Resolution: 2.8 Å
Organisms: Homo sapiens, Enterobacteria phage T4
Chains: 1
Atoms: 3,699
Mol. weight: 58.12 kDa
Ligands: CLR, OLC, TIM
Released: 17 Jun 2008

Explore 3D4S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3D4S contains 27 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 27 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	33-60	28
α-helix	62-64	3
α-helix	67-81	15
α-helix	82-86	5
α-helix	87-95	9
α-helix	102-136	35
α-helix	147-170	24
α-helix	179-186	8
α-helix	197-204	8
α-helix	205-209	5
α-helix	210-229	20
α-helix	1003-1011	9
β-strand	1014-1015	2	1
β-strand	1016	1	2
β-strand	1017-1019	3	1
β-strand	1025-1028	4	1
β-strand	1031-1034	4	1
α-helix	1039-1050	12
β-strand	1057	1	2
α-helix	1060-1080	21
α-helix	1085-1090	6
α-helix	1093-1106	14
α-helix	1108-1111	4
α-helix	1115-1122	8
α-helix	1126-1134	9
α-helix	1137-1141	5
α-helix	1143-1155	13
α-helix	267-298	32
α-helix	305-316	12
α-helix	317-320	4
α-helix	322-325	4
α-helix	326-328	3
α-helix	330-339	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-2 adrenergic receptor/T4-lysozyme chimera	A	protein	490	Homo sapiens, Enterobacteria phage T4	P00720, P07550 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3D4S_1 Beta-2 adrenergic receptor/T4-lysozyme chimera (chains A)
DYKDDDDAMGQPGNGSAFLLAPNRSHAPDHDVTQQRDEVWVVGMGIVMSLIVLAIVFGNV
LVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHILMKMWTFGNFWCEFWTSI
DVLCVTASIWTLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMH
WYRATHQEAINCYAEETCCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLNI
FEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEA
EKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQ
KRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKFCLKEHKALKTLGIIMGTFTL
CWLPFFIVNIVHVIQDNLIRKEVYILLNWIGYVNSGFNPLIYCRSPDFRIAFQELLCLRR
SSLKHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
CLR	Cholesterol	C27 H46 O	2
OLC	(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate	C21 H40 O4	3
TIM	(2S)-1-(tert-butylamino)-3-[(4-morpholin-4-yl-1,2,5-thiadiazol-3-yl)oxy]propan-…	C13 H24 N4 O3 S	1

Primary citation

A specific cholesterol binding site is established by the 2.8 A structure of the human beta2-adrenergic receptor. Hanson, M.A., Cherezov, V., Griffith, M.T. et al. Structure (2008) 16:897-905. DOI 10.1016/j.str.2008.05.001 · PubMed

Other PDB entries of the same protein (UniProt P00720), best resolution first:

2O7A 0.84 Å, T4 lysozyme C-terminal fragment
5JDT 1.0 Å, Structure of Spin-labelled T4 lysozyme mutant L118C-R1 at 100K
7LOE 1.01 Å, T4 lysozyme mutant L99A in complex with 1-fluoranylnaphthalene
7LOD 1.02 Å, T4 lysozyme mutant L99A in complex with 1-fluoranyl-4-iodanyl-benzene
7LX8 1.03 Å, T4 lysozyme mutant L99A
5XPF 1.04 Å, High-resolution X-ray structure of the T26H mutant of T4 lysozyme
6BG3 1.05 Å, Structure of (3S,4S)-1-benzyl-4-(3-(3-(trifluoromethyl)phenyl)ureido)piperidin-3-yl…
7LOF 1.05 Å, T4 lysozyme mutant L99A in complex with 2-butylthiophene
7LX6 1.05 Å, T4 lysozyme mutant L99A
7LX7 1.05 Å, T4 lysozyme mutant L99A
1SWY 1.06 Å, Use of a Halide Binding Site to Bypass the 1000-atom Limit to Ab initio Structure…
1SWZ 1.06 Å, Use of an ion-binding site to bypass the 1000-atom limit to ab initio structure…

Browse structure collections

About this viewer

MolViewer shows 3D4S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.