3D8D: Human Fe65-PTB1 domain

Crystal structure of the human Fe65-PTB1 domain. Determined by X-ray diffraction at 2.2 Å resolution. Released 10 Jun 2008.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,320
Mol. weight: 34.83 kDa
Ligands: HG
Released: 10 Jun 2008

Explore 3D8D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3D8D contains 9 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	368-379	12	1
α-helix	382-385	4
α-helix	390-401	12
β-strand	421-427	7	1
β-strand	430-434	5	1
β-strand	441-446	6	1
α-helix	447-449	3
β-strand	452-455	4	1
β-strand	464-470	7	1
β-strand	477-484	8	1
α-helix	488-504	17

Chain B: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	368-379	12	2
α-helix	383-385	3
α-helix	390-402	13
α-helix	409-410	2
β-strand	421-427	7	2
β-strand	430-434	5	2
β-strand	441-446	6	2
α-helix	447-449	3
β-strand	452-455	4	2
β-strand	464-470	7	2
β-strand	477-484	8	2
α-helix	489-505	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Amyloid beta A4 precursor protein-binding family B member 1	A, B	protein	148	Homo sapiens	O00213 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3D8D_1 Amyloid beta A4 precursor protein-binding family B member 1 (chains A, B)
GIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQLSYHKNNLHDPMSGGWGEGKDLLLQ
LEDETLKLVEPQSQALLHAQPIISIRVWGVGRDSGRERDFAYVARDKLTQMLKCHVFRCE
APAKNIATSLHEICSKIMAELEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
HG	Mercury (II) ion	Hg	6

Water and common crystallization additives (EDO) are not listed.

Primary citation

Crystal structure of the human Fe65-PTB1 domain. Radzimanowski, J., Ravaud, S., Schlesinger, S. et al. J Biol Chem (2008) 283:23113-23120. DOI 10.1074/jbc.M800861200 · PubMed

Other PDB entries of the same protein (UniProt O00213 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HO2 1.33 Å, Structure of human FE65-WW domain in complex with hMena peptide.
2OEI 1.35 Å, Crystal structure of human FE65-WW domain in complex with human Mena peptide
3DXE 2.0 Å, Crystal structure of the intracellular domain of human APP (T668A mutant) in complex…
3DXC 2.1 Å, Crystal structure of the intracellular domain of human APP in complex with Fe65-PTB2
3DXD 2.2 Å, Crystal structure of the intracellular domain of human APP (T668E mutant) in complex…
2IDH 2.28 Å, Crystal Structure of human FE65 WW domain
5NQH 2.6 Å, Structure of the human Fe65-PTB2 homodimer
3D8F 2.7 Å, Crystal structure of the human Fe65-PTB1 domain with bound phosphate (trigonal crystal…
3D8E 2.8 Å, Crystal structure of the human Fe65-PTB1 domain (trigonal crystal form)
2E45 Solution structure of Fe65 WW domain

Browse structure collections

About this viewer

MolViewer shows 3D8D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.