3DAR: D2 domain from human FGFR2

Crystal structure of D2 domain from human FGFR2. Determined by X-ray diffraction at 2.2 Å resolution. Released 10 Jun 2008.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,667
Mol. weight: 24.37 kDa
Released: 10 Jun 2008

Explore 3DAR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3DAR contains 8 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	152-156	5	1
β-strand	166-169	4	2
β-strand	175-178	4	3
β-strand	181-184	4	1
α-helix	186-187	2
β-strand	188-193	6	2
β-strand	196-197	2	2
α-helix	200-202	3
β-strand	208-210	3	3
α-helix	211-213	3
β-strand	215-218	4	3
α-helix	223-225	3
β-strand	227-235	9	2
β-strand	238-248	11	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fibroblast growth factor receptor 2	A, B	protein	105	Homo sapiens	P21802 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3DAR_1 Fibroblast growth factor receptor 2 (chains A, B)
MENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRI
GGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVV

Primary citation

Crystal structure of the FGFR2 D2 domain. Brown, A., Blundell, T.L. To be published.

Other PDB entries of the same protein (UniProt P21802 (AlphaFold model), which also has an AlphaFold model), best resolution first:

10OU 1.77 Å, FGFR2 mutant D650V with compound 12
2PVF 1.8 Å, Crystal Structure of Tyrosine Phosphorylated Activated FGF Receptor 2 (FGFR2) Kinase…
3B2T 1.8 Å, Structure of phosphotransferase
4J99 1.85 Å, Crystal Structure of FGF Receptor 2 (FGFR2) Kinase Domain Harboring the Gain-of-Function…
10OO 1.85 Å, FGFR2 mutant D650V with compound 4 (AZD3463)
5UGL 1.86 Å, Crystal Structure of FGF Receptor 2 Tyrosine Kinase Domain Harboring the D650V…
3CAF 1.96 Å, Crystal Structure of hFGFR2 D2 Domain
10OQ 1.98 Å, FGFR2 mutant D650V with compound 6
9U7S 1.99 Å, FGFR2 kinase domain with a macrocyclic compound 8r
3CLY 2.0 Å, Crystal Structure of FGF Receptor 2 (FGFR2) Kinase Domains Trapped in…
8W3D 2.04 Å, TAS-120 covalent structure with FGFR2 molecular brake mutant
5UI0 2.05 Å, Crystal Structure of the Tyrosine Kinase Domain of FGF Receptor 2 harboring an…

Browse structure collections

About this viewer

MolViewer shows 3DAR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.