3DIW: C-terminal beta-catenin bound TIP-1 structure

c-terminal beta-catenin bound TIP-1 structure. Determined by X-ray diffraction at 2.1 Å resolution. Released 21 Oct 2008.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Mus musculus
Chains: 4
Atoms: 2,002
Mol. weight: 29.92 kDa
Released: 21 Oct 2008

Explore 3DIW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3DIW contains 9 α-helices and 18 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	11-19	9	1
β-strand	21-23	3	2
β-strand	26-28	3	2
β-strand	31-35	5	1
α-helix	41-43	3
β-strand	55-60	6	1
α-helix	65-69	5
α-helix	75	1
β-strand	76-80	5	1
β-strand	83-84	2	1
α-helix	90-97	8
β-strand	104-113	10	1

Chain B: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	12-19	8	1
β-strand	21-23	3	3
β-strand	26-28	3	3
β-strand	31-35	5	1
α-helix	41-43	3
β-strand	55-60	6	1
α-helix	65-69	5
β-strand	76-80	5	1
β-strand	83-84	2	1
α-helix	90-97	8
β-strand	104-110	7	1
α-helix	112-114	3

Chain C: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	774-776	3
β-strand	778-780	3	1

Chain D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	778-780	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tax1-binding protein 3	A, B	protein	124	Mus musculus	Q9DBG9 (AlphaFold model)
decameric peptide form Catenin beta-1	C, D	protein	10		P35222 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3DIW_1 Tax1-binding protein 3 (chains A, B)
MSYTPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRV
SEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQ
SMLS

Sequence of entity 2 (C, D), FASTA

>3DIW_2 decameric peptide form Catenin beta-1 (chains C, D)
NQLAWFDTDL

Primary citation

Structural Basis of beta-Catenin Recognition by Tax-interacting Protein-1. Zhang, J., Yan, X., Shi, C. et al. J Mol Biol (2008) 384:255-263. DOI 10.1016/j.jmb.2008.09.034 · PubMed

Other PDB entries of the same protein (UniProt Q9DBG9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3DJ1 1.8 Å, crystal structure of TIP-1 wild type
3DJ3 2.4 Å, Crystal Structure of C-terminal Truncated TIP-1 (6-113)

Browse structure collections

About this viewer

MolViewer shows 3DIW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.