3DUH: Interleukin-23

Structure of Interleukin-23. Determined by X-ray diffraction at 2.3 Å resolution. Released 19 Aug 2008.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 4
Atoms: 7,010
Mol. weight: 111.34 kDa
Ligands: NAG
Released: 19 Aug 2008

Explore 3DUH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3DUH contains 23 α-helices and 53 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	1-5	5	1
β-strand	8-14	7	1
β-strand	22-27	6	2
β-strand	37-40	4	1
β-strand	48-49	2	1
β-strand	52-57	6	2
α-helix	60-62	3
β-strand	64-70	7	1
β-strand	73-85	13	1
β-strand	90	1	1
α-helix	96-97	2
β-strand	108-110	3	3
β-strand	111	1	4
β-strand	117-124	8	3
β-strand	130-138	9	1
β-strand	144-145	2	1
β-strand	146-148	3	3
β-strand	152-155	4	3
β-strand	165-173	9	3
β-strand	186-194	9	1
β-strand	197-205	9	1
α-helix	207-210	4
β-strand	211	1	4
α-helix	213-216	4
β-strand	217-223	7	5
α-helix	224	1
β-strand	229-235	7	5
β-strand	249-257	9	6
β-strand	264-269	6	6
β-strand	273-277	5	5
β-strand	282-290	9	6
α-helix	296-300	5
β-strand	301-304	4	6

Chain B: 5 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	1-5	5	7
β-strand	8-14	7	7
β-strand	22-27	6	8
β-strand	36-39	4	7
β-strand	48-49	2	7
β-strand	52-57	6	8
α-helix	60-62	3
β-strand	64-70	7	7
β-strand	73-86	14	7
β-strand	89-90	2	7
β-strand	108-110	3	7
β-strand	111	1	9
β-strand	117-124	8	7
β-strand	130-138	9	7
α-helix	143	1
β-strand	144-148	5	7
β-strand	152-155	4	7
β-strand	165-173	9	7
α-helix	185	1
β-strand	186-194	9	7
β-strand	197-205	9	7
α-helix	207-210	4
β-strand	211	1	9
α-helix	213-216	4
β-strand	217-223	7	10
β-strand	230-235	6	10
β-strand	249-256	8	11
β-strand	265-269	5	11
β-strand	273-276	4	10
β-strand	283-290	8	11
β-strand	301-304	4	11

Chain C: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	7-9	3
α-helix	11-25	15
α-helix	54-56	3
α-helix	60-65	6
α-helix	67-86	20
α-helix	102-116	15
α-helix	139-167	29

Chain D: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	11-26	16
α-helix	54-56	3
α-helix	60-86	27
α-helix	102-116	15
α-helix	143-167	25

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-12 subunit beta	A, B	protein	314	Homo sapiens	P29460 (AlphaFold model)
Interleukin-23 subunit alpha	C, D	protein	177	Homo sapiens	Q9NPF7 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3DUH_1 Interleukin-12 subunit beta (chains A, B)
LEIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVK
EFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRF
TCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACP
AAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPD
TWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWS
EWASVPCSHHHHHH

Sequence of entity 2 (C, D), FASTA

>3DUH_2 Interleukin-23 subunit alpha (chains C, D)
LRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCD
PQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPE
GHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSPHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

The structure of interleukin-23 reveals the molecular basis of p40 subunit sharing with interleukin-12. Lupardus, P.J., Garcia, K.C. J Mol Biol (2008) 382:931-941. DOI 10.1016/j.jmb.2008.07.051 · PubMed

Other PDB entries of the same protein (UniProt P29460 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MJ3 1.74 Å, Interleukin-23 complex with an antagonistic alphabody, crystal form 1
3D85 1.9 Å, Crystal structure of IL-23 in complex with neutralizing FAB
8CR8 2.0 Å, human Interleukin-23
8UUI 2.43 Å, X-ray structure of Interleukin-23 in complex with peptide 23-446
1F42 2.5 Å, The P40 domain of human interleukin-12
5MXA 2.5 Å, Structure of unbound Interleukin-23
4GRW 2.55 Å, Structure of a complex of human IL-23 with 3 Nanobodies (Llama vHHs)
6UIB 2.74 Å, Crystal structure of IL23 bound to peptide 23-652
1F45 2.8 Å, Human interleukin-12
5MZV 2.8 Å, IL-23:IL-23R:Nb22E11 complex
3D87 2.9 Å, Crystal structure of Interleukin-23
3HMX 3.0 Å, Crystal structure of ustekinumab FAB/IL-12 complex

Browse structure collections

About this viewer

MolViewer shows 3DUH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.