8UUI: Interleukin-23

X-ray structure of Interleukin-23 in complex with peptide 23-446. Determined by X-ray diffraction at 2.43 Å resolution. Released 9 Jul 2025.

Method: X-ray diffraction
Resolution: 2.43 Å
Organisms: Homo sapiens, unidentified
Chains: 3
Atoms: 3,412
Mol. weight: 57.71 kDa
Released: 9 Jul 2025

Explore 8UUI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8UUI contains 17 α-helices and 28 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	24-25	2	2
β-strand	30-36	7	2
β-strand	44-49	6	3
β-strand	58-62	5	2
β-strand	71	1	2
β-strand	74-79	6	3
α-helix	82-84	3
β-strand	86-92	7	2
β-strand	95-108	14	2
β-strand	111-112	2	2
β-strand	130-132	3	2
β-strand	133	1	4
β-strand	139-146	8	2
β-strand	152-160	9	2
β-strand	166-170	5	2
β-strand	174-181	8	2
β-strand	184-195	12	2
α-helix	203-204	2
β-strand	208-216	9	2
β-strand	219-227	9	2
α-helix	229-232	4
β-strand	233	1	4
α-helix	235-238	4
β-strand	239-244	6	5
β-strand	253-257	5	5
β-strand	271-278	8	6
β-strand	287-291	5	6
β-strand	295-297	3	5
β-strand	305-312	8	6
α-helix	318-322	5
β-strand	323-326	4	6

Chain B: 9 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	30-44	15
α-helix	73-75	3
α-helix	79-84	6
α-helix	86-104	19
α-helix	114	1
β-strand	115	1	1
α-helix	116	1
α-helix	120-123	4
α-helix	124-135	12
α-helix	158-186	29

Chain D: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	4-6	3
α-helix	7-10	4
α-helix	12-15	4
β-strand	18	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-23 subunit alpha	B	protein	176	Homo sapiens	Q9NPF7 (AlphaFold model)
Interleukin-12 subunit beta	A	protein	307	Homo sapiens	P29460 (AlphaFold model)
peptide 23-446	D	protein	20	unidentified

Sequence of entity 1 (B), FASTA

>8UUI_1 Interleukin-23 subunit alpha (chains B)
RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDP
QGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEG
HHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSPHHHHHH

Sequence of entity 2 (A), FASTA

>8UUI_2 Interleukin-12 subunit beta (chains A)
AIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKE
FGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFT
CWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPA
AEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDT
WSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSE
WASVPCS

Sequence of entity 3 (D), FASTA

>8UUI_3 peptide 23-446 (chains D)
GLRERCVRNYGHEFCQNWYW

Primary citation

Identification of an Induced Orthosteric Pocket in IL-23: A New Avenue for Non-biological Therapeutic Targeting. Lecomte, F.C., Joseph, J.S., Stalewski, J. et al. ACS Chem Biol (2025) 20:1609-1618. DOI 10.1021/acschembio.5c00181 · PubMed

Other PDB entries of the same protein (UniProt Q9NPF7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MJ3 1.74 Å, Interleukin-23 complex with an antagonistic alphabody, crystal form 1
3D85 1.9 Å, Crystal structure of IL-23 in complex with neutralizing FAB
8CR8 2.0 Å, human Interleukin-23
3DUH 2.3 Å, Structure of Interleukin-23
5MXA 2.5 Å, Structure of unbound Interleukin-23
4GRW 2.55 Å, Structure of a complex of human IL-23 with 3 Nanobodies (Llama vHHs)
6UIB 2.74 Å, Crystal structure of IL23 bound to peptide 23-652
5MZV 2.8 Å, IL-23:IL-23R:Nb22E11 complex
3D87 2.9 Å, Crystal structure of Interleukin-23
3QWR 3.25 Å, Crystal structure of IL-23 in complex with an adnectin
5MJ4 3.4 Å, Interleukin-23 complex with an antagonistic alphabody, crystal form 2
6WDQ 3.4 Å, IL23/IL23R/IL12Rb1 signaling complex

Browse structure collections

About this viewer

MolViewer shows 8UUI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.