5MXA: Unbound Interleukin-23

Name: PDB 5MXA: Structure of unbound Interleukin-23
Published: 2017-12-20
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: cytokine

Structure of unbound Interleukin-23. Determined by X-ray diffraction at 2.5 Å resolution. Released 20 Dec 2017.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,484
Mol. weight: 59.83 kDa
Released: 20 Dec 2017

Explore 5MXA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5MXA contains 12 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	24-27	4	1
β-strand	30-36	7	1
β-strand	44-49	6	2
β-strand	58-62	5	1
β-strand	65-71	7	1
β-strand	74-79	6	2
β-strand	86-92	7	1
β-strand	95-108	14	1
β-strand	111-112	2	1
α-helix	118-119	2
β-strand	130-132	3	1
β-strand	133	1	3
β-strand	139-146	8	1
β-strand	152-160	9	1
α-helix	165	1
β-strand	166-170	5	1
β-strand	174-181	8	1
β-strand	184-195	12	1
β-strand	208-216	9	1
β-strand	219-227	9	1
α-helix	229-231	3
β-strand	233	1	3
α-helix	235-238	4
β-strand	239-246	8	4
β-strand	251-257	7	4
β-strand	271-278	8	5
β-strand	286-291	6	5
β-strand	295-299	5	4
β-strand	305-312	8	5
α-helix	318-322	5
β-strand	323-326	4	5

Chain B: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	30-45	16
α-helix	73-75	3
α-helix	79-104	26
α-helix	107-110	4
α-helix	114-116	3
α-helix	121-135	15
α-helix	155-186	32

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-23 subunit alpha	B	protein	198	Homo sapiens	Q9NPF7 (AlphaFold model)
Interleukin-12 subunit beta	A	protein	328	Homo sapiens	P29460 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>5MXA_1 Interleukin-23 subunit alpha (chains B)
MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEG
DEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSP
VGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVF
AHGAATLSPGTKHHHHHH

Sequence of entity 2 (A), FASTA

>5MXA_2 Interleukin-12 subunit beta (chains A)
MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITW
TLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQ
KEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERV
RGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKN
LQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVIC
RKNASISVRAQDRYYSSSWSEWASVPCS

Primary citation

Structural Activation of Pro-inflammatory Human Cytokine IL-23 by Cognate IL-23 Receptor Enables Recruitment of the Shared Receptor IL-12R beta 1. Bloch, Y., Bouchareychas, L., Merceron, R. et al. Immunity (2018) 48:45-58.e6. DOI 10.1016/j.immuni.2017.12.008 · PubMed

Other PDB entries of the same protein (UniProt Q9NPF7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MJ3 1.74 Å, Interleukin-23 complex with an antagonistic alphabody, crystal form 1
3D85 1.9 Å, Crystal structure of IL-23 in complex with neutralizing FAB
8CR8 2.0 Å, human Interleukin-23
3DUH 2.3 Å, Structure of Interleukin-23
8UUI 2.43 Å, X-ray structure of Interleukin-23 in complex with peptide 23-446
4GRW 2.55 Å, Structure of a complex of human IL-23 with 3 Nanobodies (Llama vHHs)
6UIB 2.74 Å, Crystal structure of IL23 bound to peptide 23-652
5MZV 2.8 Å, IL-23:IL-23R:Nb22E11 complex
3D87 2.9 Å, Crystal structure of Interleukin-23
3QWR 3.25 Å, Crystal structure of IL-23 in complex with an adnectin
5MJ4 3.4 Å, Interleukin-23 complex with an antagonistic alphabody, crystal form 2
6WDQ 3.4 Å, IL23/IL23R/IL12Rb1 signaling complex

Browse structure collections

About this viewer

MolViewer shows 5MXA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.