3DYR: Thioredoxin-1

Crystal structure of E. coli thioredoxin mutant I76T in its oxidized form. Determined by X-ray diffraction at 2.0 Å resolution. Released 27 Jan 2009.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Escherichia coli
Chains: 2
Atoms: 1,733
Mol. weight: 23.75 kDa
Released: 27 Jan 2009

Explore 3DYR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3DYR contains 11 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	6-8	3	1
α-helix	13	1
α-helix	14-18	5
β-strand	24-29	6	1
α-helix	34-49	16
β-strand	55-60	6	1
α-helix	67-70	4
β-strand	78-83	6	1
β-strand	86-92	7	1
α-helix	97-109	13

Chain B: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	5	1
β-strand	6-7	2	2
α-helix	13	1
α-helix	14-18	5
β-strand	23-29	7	2
α-helix	34-49	16
β-strand	54-60	7	2
α-helix	68-71	4
β-strand	78-83	6	2
β-strand	86-92	7	2
α-helix	97-108	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Thioredoxin-1	A, B	protein	111	Escherichia coli	P0AA25 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3DYR_1 Thioredoxin-1 (chains A, B)
GSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLN
IDQNPGTAPKYGIRGTPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAAA

Primary citation

Properties of the thioredoxin fold superfamily are modulated by a single amino acid residue. Ren, G., Stephan, D., Xu, Z. et al. J Biol Chem (2009) 284:10150-10159. DOI 10.1074/jbc.M809509200 · PubMed

Other PDB entries of the same protein (UniProt P0AA25 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HUA 1.1 Å, E. coli thioredoxin variant with (4R)-FluoroPro76 as single proline residue
5HR3 1.1 Å, Crystal structure of thioredoxin N106A mutant
5HR2 1.2 Å, Crystal structure of thioredoxin L94A mutant
5HR0 1.31 Å, Crystal structure of thioredoxin E101G mutant
4HU7 1.4 Å, E. coli thioredoxin variant with Pro76 as single proline residue
4HU9 1.55 Å, E. coli thioredoxin variant with (4S)-FluoroPro76 as single proline residue
4X43 1.65 Å, Structure of proline-free E. coli Thioredoxin
2TRX 1.68 Å, Crystal structure of thioredoxin from escherichia coli at 1.68 Å resolution
6Y4Y 1.75 Å, The crystal structure of human MACROD2 in space group P41212
1KEB 1.8 Å, Crystal Structure of Double Mutant M37L,P40S E.coli Thioredoxin
2EIQ 1.9 Å, Design of Disulfide-linked Thioredoxin Dimers and Multimers Through Analysis of Crystal…
6Y4Z 1.9 Å, The crystal structure of human MACROD2 in space group P43212

Browse structure collections

About this viewer

MolViewer shows 3DYR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.