Structure of the Leukemia Inhibitory Factor Receptor (LIF-R) domains D1-D5. Determined by X-ray diffraction at 3.1 Å resolution. Released 23 Sept 2008.
Explore 3E0G in 3D Show helices and sheets RCSB PDB PDBe
3E0G contains 10 α-helices and 47 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-5 | 2 | 1 |
| β-strand | 6 | 1 | 2 |
| β-strand | 11-12 | 2 | 3 |
| β-strand | 13-14 | 2 | 1 |
| β-strand | 15 | 1 | 4 |
| β-strand | 28-32 | 5 | 5 |
| β-strand | 38-42 | 5 | 5 |
| β-strand | 46 | 1 | 4 |
| β-strand | 49-50 | 2 | 3 |
| β-strand | 59-62 | 4 | 5 |
| β-strand | 75-76 | 2 | 5 |
| β-strand | 82-83 | 2 | 2 |
| β-strand | 90 | 1 | 6 |
| β-strand | 94-96 | 3 | 6 |
| β-strand | 101-108 | 8 | 6 |
| α-helix | 110-112 | 3 | |
| β-strand | 118-126 | 9 | 7 |
| β-strand | 132-141 | 10 | 7 |
| α-helix | 143-145 | 3 | |
| β-strand | 148-155 | 8 | 6 |
| β-strand | 165-174 | 10 | 7 |
| β-strand | 181-182 | 2 | 2 |
| α-helix | 183-190 | 8 | |
| β-strand | 191-193 | 3 | 7 |
| β-strand | 203-204 | 2 | 8 |
| β-strand | 208-211 | 4 | 9 |
| β-strand | 216-220 | 5 | 8 |
| β-strand | 226-230 | 5 | 9 |
| β-strand | 236 | 1 | 9 |
| α-helix | 237-238 | 2 | |
| β-strand | 239-240 | 2 | 8 |
| β-strand | 246-250 | 5 | 8 |
| α-helix | 260 | 1 | |
| β-strand | 261-267 | 7 | 9 |
| β-strand | 271-279 | 9 | 9 |
| α-helix | 282-285 | 4 | |
| β-strand | 286-291 | 6 | 10 |
| β-strand | 292 | 1 | 11 |
| β-strand | 297-303 | 7 | 10 |
| α-helix | 312-314 | 3 | |
| β-strand | 317-322 | 6 | 12 |
| β-strand | 328-331 | 4 | 12 |
| β-strand | 342-347 | 6 | 10 |
| α-helix | 348-349 | 2 | |
| β-strand | 355-362 | 8 | 12 |
| β-strand | 367-374 | 8 | 12 |
| α-helix | 376-379 | 4 | |
| β-strand | 380 | 1 | 11 |
| α-helix | 382-385 | 4 | |
| β-strand | 386-390 | 5 | 13 |
| β-strand | 400-403 | 4 | 13 |
| β-strand | 412 | 1 | 14 |
| β-strand | 416-420 | 5 | 15 |
| β-strand | 428-430 | 3 | 15 |
| β-strand | 434 | 1 | 14 |
| β-strand | 440 | 1 | 13 |
| β-strand | 455-459 | 5 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Leukemia inhibitory factor receptor | A | protein | 483 | Homo sapiens | P42702 (AlphaFold model) |
>3E0G_1 Leukemia inhibitory factor receptor (chains A) DLKCVTNNLQVWQCSWKAPSGTGRGTDYEVCIEQRSRSCYQLEKTSIKIPALSHGDYEIT INSLHDFGSSTSKFTLNEQNVSLIPDTPEILQLSADFSTSTLYLKWNDRGSVFPHRSNVI WEIKVLRKESMELVKLVTHQTTLNGKDTLHHWSWASDMPLECAIHFVEIRCYIDNLHFSG LEEWSDWSPVKQISWIPDSQTKVFPQDKVILVGSDITFCCVSQEKVLSALIGHTNCPLIH LDGENVAIKIRNISVSASSGTNVVFTTEDNIFGTVIFAGYPPDTPQQLNCETHDLKEIIC SWNPGRVTALVGPRATSYTLVESFSGKYVRLKRAEAPTNESYQLLFQMLPNQEIYNFTLN AHNPLGRSQSTILVNITEKVYPHTPTSFKVKDINSTAVKLSWHLPGNFAKINFLCEIEIK KSNSVQEQRNVTIQGVENSSYLVALDKLNPYTLYTFRIRCSTETFWKWSKWSNKKQHLTT EAS
Structural organization of a full-length gp130/LIF-R cytokine receptor transmembrane complex. Skiniotis, G., Lupardus, P.J., Martick, M. et al. Mol Cell (2008) 31:737-748. DOI 10.1016/j.molcel.2008.08.011 · PubMed
Other PDB entries of the same protein (UniProt P42702 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3E0G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.