3ECS: Human eIF2B alpha

Crystal structure of human eIF2B alpha. Determined by X-ray diffraction at 2.65 Å resolution. Released 1 Sept 2009.

Method

X-ray diffraction

Resolution

2.65 Å

Organism

Homo sapiens

Chains

8

Atoms

17,958

Mol. weight

283.03 kDa

Released

1 Sept 2009

Explore 3ECS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3ECS contains 150 α-helices and 95 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 12 β-strands

Molecules and chains

>3ECS_1 Translation initiation factor eIF-2B subunit alpha (chains A, B, C, D, E, F, G, H)
MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVD
SSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIK
DGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLD
AAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFP
LNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDEL
IKLYLAAAEHHHHHH

Primary citation

Crystal structure of the alpha subunit of human translation initiation factor 2B. Hiyama, T.B., Ito, T., Imataka, H. et al. J Mol Biol (2009) 392:937-951. DOI 10.1016/j.jmb.2009.07.054 · PubMed

Related structures

Other PDB entries of the same protein (UniProt Q14232 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 9Y4B 2.1 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
• 9ZUZ 2.25 Å, Translation Initiation Factor eIF-2B complex with the Isohexide Diamine GSK735
• 7VLK 2.27 Å, eIF2B-SFSV NSs C2-imposed
• 9Y3U 2.4 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
• 9Y4W 2.4 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
• 7F64 2.42 Å, eIF2B-SFSV NSs
• 9Y3T 2.5 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
• 7RLO 2.6 Å, Structure of the human eukaryotic translation initiation factor 2B (eIF2B) in complex…
• 7KMA 2.7 Å, Crystal structure of eif2Balpha with a ligand.
• 9HVE 2.7 Å, Native human eIF2-eIF2B complex
• 7F66 2.76 Å, eIF2B-SFSV NSs-1-eIF2
• 9Y5T 2.78 Å, eIF2B lacking the latch helix bound to ISRACT-02 (Active state)

Browse structure collections

About this viewer

MolViewer shows 3ECS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.