3EIQ: Pdcd4-eIF4A

Crystal structure of Pdcd4-eIF4A. Determined by X-ray diffraction at 3.5 Å resolution. Released 24 Feb 2009.

Method: X-ray diffraction
Resolution: 3.5 Å
Organisms: Homo sapiens, Mus musculus
Chains: 3
Atoms: 8,080
Mol. weight: 133.83 kDa
Released: 24 Feb 2009

Explore 3EIQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3EIQ contains 59 α-helices and 28 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	23-25	3
α-helix	34-37	4
α-helix	41-49	9
α-helix	57-67	11
β-strand	72-74	3	1
α-helix	77	1
α-helix	79	1
α-helix	83-93	11
β-strand	103-106	4	1
α-helix	110-123	14
α-helix	124-126	3
β-strand	131-133	3	1
α-helix	140-147	8
β-strand	154-157	4	1
α-helix	159-168	10
β-strand	178-181	4	1
α-helix	184-187	4
α-helix	188-192	5
α-helix	193-200	8
β-strand	208-212	5	1
α-helix	218-224	7
β-strand	232-234	3	1
β-strand	248-252	5	2
α-helix	259-268	10
β-strand	276-278	3	2
α-helix	282-293	12
β-strand	300-301	2	2
α-helix	307-318	12
β-strand	326-328	3	2
α-helix	338-340	3
β-strand	344-346	3	2
α-helix	354-359	6
β-strand	372-376	5	2
α-helix	380-390	11
β-strand	396-397	2	2

Chain C: 17 helices, 0 β-strands

Element	Residues	Length
α-helix	162-178	17
α-helix	181-189	9
α-helix	195-199	5
α-helix	200-208	9
α-helix	213-224	12
α-helix	233-245	13
α-helix	247-253	7
α-helix	257-270	14
α-helix	280-282	3
α-helix	289-302	14
α-helix	324-341	18
α-helix	344-354	11
α-helix	360-373	14
α-helix	378-392	15
α-helix	398-418	21
α-helix	422-436	15
α-helix	441-444	4

Chain D: 21 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	34-37	4
α-helix	41-49	9
α-helix	59-67	9
β-strand	72-74	3	3
α-helix	79	1
α-helix	83-93	11
β-strand	103-106	4	3
α-helix	110-123	14
α-helix	124-126	3
β-strand	131-133	3	3
α-helix	140-147	8
β-strand	154-157	4	3
α-helix	159-168	10
β-strand	178-181	4	3
α-helix	184-187	4
α-helix	188-192	5
α-helix	193-200	8
β-strand	208-212	5	3
α-helix	218-225	8
β-strand	232-234	3	3
β-strand	247-252	6	4
α-helix	257-269	13
β-strand	276-278	3	4
α-helix	282-293	12
β-strand	300-301	2	4
α-helix	307-317	11
β-strand	326-328	3	4
α-helix	332-335	4
α-helix	338-340	3
β-strand	343-346	4	4
α-helix	354-359	6
β-strand	371-376	6	4
α-helix	380-390	11
β-strand	396-397	2	4
α-helix	398	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Eukaryotic initiation factor 4A-I	A, D	protein	414	Homo sapiens	P60842 (AlphaFold model)
Programmed cell death protein 4	C	protein	358	Mus musculus	Q61823 (AlphaFold model)

Sequence of entity 1 (A, D), FASTA

>3EIQ_1 Eukaryotic initiation factor 4A-I (chains A, D)
GPLGSPEFMSASQDSRSRDNGPDGMEPEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGF
EKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLKATQALVLAPTREL
AQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQMEAPHIIVGTPGRVFDMLNRRYLS
PKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPI
RILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKM
HARDFTVSAMHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTN
RENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIEEMPLNVADLI

Sequence of entity 2 (C), FASTA

>3EIQ_2 Programmed cell death protein 4 (chains C)
GPLGSPEFGKGVWGTPGQVYDVEEVDVKDPNYDDDQENCVYETVVLPLDETAFEKTLTPI
IQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVM
STNDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQA
RAALDKATVLLSMSKGGKRKDSVWGSGGGQQPVNHLVKEIDMLLKEYLLSGDISEAEHCL
KELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNE
IPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPSRGRKRFVSEGDGGRLKPESY

Primary citation

Structural basis for translational inhibition by the tumour suppressor Pdcd4. Loh, P.G., Yang, H.S., Walsh, M.A. et al. EMBO J (2009) 28:274-285. DOI 10.1038/emboj.2008.278 · PubMed

Other PDB entries of the same protein (UniProt P60842 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5ZBZ 1.31 Å, Crystal structure of the DEAD domain of Human eIF4A with sanguinarine
9DTS 1.69 Å, Crystal structure of the human eIF4A1/AMPPNP/amidino-rocaglate/polypurine RNA complex
9I9G 1.7 Å, Crystal structure of human eIF4A1 C-terminal domain in complex with hippuristanol
9AVR 1.91 Å, Human eIF4A-1 in complex with AMP-PNP, RNA, and the inhibitor silvestrol
5ZC9 2.0 Å, Crystal structure of the human eIF4A1-ATP analog-RocA-polypurine RNA complex
2G9N 2.25 Å, Structure of the DEAD domain of Human eukaryotic initiation factor 4A, eIF4A
7PPZ 2.52 Å, Crystal structure of the Burkholderia Lethal Factor 1 (BLF1) C94S inactive mutant in…
9I9F 2.73 Å, Crystal structure of apoform human eIF4A1 C-terminal domain
2ZU6 2.8 Å, crystal structure of the eIF4A-PDCD4 complex
7PQ0 3.0 Å, Crystal structure of the Burkholderia Lethal Factor 1 (BLF1) C94S inactive mutant in…
8OZ0 3.5 Å, Structure of a human 48S translation initiation complex with eIF4F and eIF4A
8XXN 3.6 Å, Cryo-EM structure of the human 43S ribosome with PDCD4

Browse structure collections

About this viewer

MolViewer shows 3EIQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.