3EJB: P450BioI
Crystal Structure of P450BioI in complex with tetradecanoic acid ligated Acyl Carrier Protein. Determined by X-ray diffraction at 2.0 Å resolution. Released 7 Oct 2008.
- Method
- X-ray diffraction
- Resolution
- 2.0 Å
- Organisms
- Escherichia coli, Bacillus subtilis
- Chains
- 8
- Atoms
- 16,422
- Mol. weight
- 233.86 kDa
- Ligands
- HEM, HTG, ZMP
- Released
- 7 Oct 2008
Explore 3EJB in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
3EJB contains 113 α-helices and 66 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 6 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 20-22 | 3 | |
| α-helix | 23-34 | 12 | |
| α-helix | 37-38 | 2 | |
| β-strand | 47 | 1 | 1 |
| α-helix | 58-69 | 12 | |
| α-helix | 76-81 | 6 | |
| β-strand | 84 | 1 | 1 |
| α-helix | 85-94 | 10 | |
Chain B: 23 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 10-13 | 4 | |
| α-helix | 15-25 | 11 | |
| β-strand | 28-33 | 6 | 2 |
| β-strand | 36-41 | 6 | 2 |
| α-helix | 44-52 | 9 | |
| β-strand | 56-57 | 2 | 2 |
| α-helix | 70-77 | 8 | |
| α-helix | 80-82 | 3 | |
| α-helix | 87-96 | 10 | |
| α-helix | 97-99 | 3 | |
| α-helix | 101-105 | 5 | |
| α-helix | 108-120 | 13 | |
| β-strand | 127-129 | 3 | 3 |
| α-helix | 130 | 1 | |
| α-helix | 131-135 | 5 | |
| α-helix | 136-147 | 12 | |
| α-helix | 151-153 | 3 | |
| α-helix | 154-165 | 12 | |
| α-helix | 166-168 | 3 | |
| α-helix | 174-200 | 27 | |
| α-helix | 206-212 | 7 | |
| α-helix | 221-251 | 31 | |
| α-helix | 254-262 | 9 | |
| α-helix | 264-266 | 3 | |
| α-helix | 267-277 | 11 | |
| β-strand | 281 | 1 | 4 |
| β-strand | 283-288 | 6 | 2 |
| β-strand | 292-294 | 3 | 5 |
| β-strand | 297-299 | 3 | 5 |
| β-strand | 304-308 | 5 | 2 |
| α-helix | 309-312 | 4 | |
| α-helix | 347-364 | 18 | |
| β-strand | 369-370 | 2 | 3 |
| β-strand | 377 | 1 | 6 |
| β-strand | 383 | 1 | 4 |
| β-strand | 386 | 1 | 6 |
| β-strand | 390-392 | 3 | 3 |
Chain C: 6 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 20-22 | 3 | |
| α-helix | 23-35 | 13 | |
| α-helix | 39-41 | 3 | |
| β-strand | 47 | 1 | 7 |
| α-helix | 58-69 | 12 | |
| α-helix | 76-81 | 6 | |
| β-strand | 84 | 1 | 7 |
| α-helix | 85-92 | 8 | |
Chain D: 23 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 7-13 | 7 | |
| α-helix | 15-25 | 11 | |
| β-strand | 28-33 | 6 | 8 |
| β-strand | 36-41 | 6 | 8 |
| α-helix | 44-52 | 9 | |
| β-strand | 56-57 | 2 | 8 |
| α-helix | 70-77 | 8 | |
| α-helix | 80-82 | 3 | |
| α-helix | 87-96 | 10 | |
| α-helix | 101-105 | 5 | |
| α-helix | 108-120 | 13 | |
| β-strand | 127-129 | 3 | 9 |
| α-helix | 130 | 1 | |
| α-helix | 131-135 | 5 | |
| α-helix | 136-147 | 12 | |
| α-helix | 154-164 | 11 | |
| α-helix | 165-168 | 4 | |
| α-helix | 174-200 | 27 | |
| α-helix | 206-211 | 6 | |
| α-helix | 221-236 | 16 | |
| α-helix | 238-252 | 15 | |
| α-helix | 254-262 | 9 | |
| α-helix | 264-266 | 3 | |
| α-helix | 267-277 | 11 | |
| β-strand | 281 | 1 | 10 |
| β-strand | 283-288 | 6 | 8 |
| β-strand | 292-294 | 3 | 11 |
| β-strand | 297-299 | 3 | 11 |
| β-strand | 304-308 | 5 | 8 |
| α-helix | 309-312 | 4 | |
| α-helix | 340-342 | 3 | |
| α-helix | 347-364 | 18 | |
| β-strand | 369-370 | 2 | 9 |
| β-strand | 377 | 1 | 12 |
| β-strand | 383 | 1 | 10 |
| β-strand | 386 | 1 | 12 |
| β-strand | 390-392 | 3 | 9 |
Chain E: 5 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 20-22 | 3 | |
| α-helix | 23-35 | 13 | |
| β-strand | 47 | 1 | 13 |
| α-helix | 58-69 | 12 | |
| α-helix | 76-79 | 4 | |
| β-strand | 84 | 1 | 13 |
| α-helix | 85-93 | 9 | |
Chain F: 21 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 15-25 | 11 | |
| β-strand | 28-33 | 6 | 14 |
| β-strand | 36-41 | 6 | 14 |
| α-helix | 44-52 | 9 | |
| β-strand | 56-57 | 2 | 14 |
| α-helix | 70-77 | 8 | |
| α-helix | 80-82 | 3 | |
| α-helix | 87-95 | 9 | |
| α-helix | 96-99 | 4 | |
| α-helix | 101-105 | 5 | |
| α-helix | 108-120 | 13 | |
| β-strand | 127-129 | 3 | 15 |
| α-helix | 130-135 | 6 | |
| α-helix | 136-147 | 12 | |
| α-helix | 151-153 | 3 | |
| α-helix | 154-165 | 12 | |
| α-helix | 166-168 | 3 | |
| α-helix | 174-200 | 27 | |
| α-helix | 206-212 | 7 | |
| α-helix | 221-252 | 32 | |
| α-helix | 254-262 | 9 | |
| α-helix | 264-266 | 3 | |
| α-helix | 267-277 | 11 | |
| β-strand | 281 | 1 | 16 |
| β-strand | 283-288 | 6 | 14 |
| β-strand | 292-294 | 3 | 17 |
| β-strand | 297-299 | 3 | 17 |
| β-strand | 304-308 | 5 | 14 |
| α-helix | 309-312 | 4 | |
| α-helix | 347-364 | 18 | |
| β-strand | 369-370 | 2 | 15 |
| β-strand | 377 | 1 | 18 |
| β-strand | 383 | 1 | 16 |
| β-strand | 386 | 1 | 18 |
| β-strand | 390-392 | 3 | 15 |
Chain G: 6 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 20-22 | 3 | |
| α-helix | 23-35 | 13 | |
| α-helix | 39-41 | 3 | |
| β-strand | 47 | 1 | 19 |
| α-helix | 58-69 | 12 | |
| α-helix | 76-79 | 4 | |
| β-strand | 84 | 1 | 19 |
| α-helix | 85-92 | 8 | |
Chain H: 23 helices, 16 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 7-13 | 7 | |
| α-helix | 15-25 | 11 | |
| β-strand | 28-33 | 6 | 20 |
| β-strand | 36-41 | 6 | 20 |
| α-helix | 44-52 | 9 | |
| β-strand | 56-57 | 2 | 20 |
| α-helix | 70-77 | 8 | |
| α-helix | 80-82 | 3 | |
| α-helix | 87-95 | 9 | |
| α-helix | 96-98 | 3 | |
| α-helix | 101-105 | 5 | |
| α-helix | 108-120 | 13 | |
| β-strand | 127-129 | 3 | 21 |
| α-helix | 130-135 | 6 | |
| α-helix | 136-147 | 12 | |
| α-helix | 151-153 | 3 | |
| α-helix | 154-164 | 11 | |
| α-helix | 165-168 | 4 | |
| α-helix | 174-200 | 27 | |
| α-helix | 206-212 | 7 | |
| β-strand | 214 | 1 | 22 |
| β-strand | 217 | 1 | 22 |
| α-helix | 221-252 | 32 | |
| α-helix | 254-262 | 9 | |
| α-helix | 264-266 | 3 | |
| α-helix | 267-277 | 11 | |
| β-strand | 281 | 1 | 23 |
| β-strand | 284-288 | 5 | 20 |
| β-strand | 292-294 | 3 | 24 |
| β-strand | 297-299 | 3 | 24 |
| β-strand | 304-307 | 4 | 20 |
| α-helix | 309-312 | 4 | |
| α-helix | 340-342 | 3 | |
| α-helix | 347-363 | 17 | |
| β-strand | 369-370 | 2 | 21 |
| β-strand | 377 | 1 | 25 |
| β-strand | 383 | 1 | 23 |
| β-strand | 386 | 1 | 25 |
| β-strand | 390-392 | 3 | 21 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Acyl carrier protein | A, C, E, G | protein | 97 | Escherichia coli | P0A6A8 (AlphaFold model) |
| Biotin biosynthesis cytochrome P450-like enzyme | B, D, F, H | protein | 404 | Bacillus subtilis | P53554 (AlphaFold model) |
Sequence of entity 1 (A, C, E, G), FASTA
>3EJB_1 Acyl carrier protein (chains A, C, E, G)
GSSHHHHHHSSGLVPRGSHMSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTV
ELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA
Sequence of entity 2 (B, D, F, H), FASTA
>3EJB_2 Biotin biosynthesis cytochrome P450-like enzyme (chains B, D, F, H)
TIASSTASSEFLKNPYSFYDTLRAVHPIYKGSFLKYPGWYVTGYEETAAILKDARFKVRT
PLPESSTKYQDLSHVQNQMMLFQNQPDHRRLRTLASGAFTPRTTESYQPYIIETVHHLLD
QVQGKKKMEVISDFAFPLASFVIANIIGVPEEDREQLKEWAASLIQTIDFTRSRKALTEG
NIMAVQAMAYFKELIQKRKRHPQQDMISMLLKGREKDKLTEEEAASTCILLAIAGHETTV
NLISNSVLCLLQHPEQLLKLRENPDLIGTAVEECLRYESPTQMTARVASEDIDICGVTIR
QGEQVYLLLGAANRDPSIFTNPDVFDITRSPNPHLSFGHGHHVCLGSSLARLEAQIAINT
LLQRMPSLNLADFEWRYRPLFGFRALEELPVTFEASWSHPQFEK
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| HEM | Protoporphyrin IX containing FE | C34 H32 Fe N4 O4 | 4 |
| HTG | heptyl 1-thio-beta-D-glucopyranoside | C13 H26 O5 S | 8 |
| ZMP | S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}ami… | C25 H49 N2 O8 P S | 4 |
Water and common crystallization additives (CL) are not listed.
Primary citation
Structural insights from a P450 Carrier Protein complex reveal how specificity is achieved in the P450(BioI) ACP complex. Cryle, M.J., Schlichting, I. Proc Natl Acad Sci U S A (2008) 105:15696-15701. DOI 10.1073/pnas.0805983105 · PubMed
Other PDB entries of the same protein (UniProt P0A6A8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1T8K 1.1 Å, Crystal Structure of apo acyl carrier protein from E. coli
- 1L0I 1.2 Å, Crystal structure of butyryl-ACP I62M mutant
- 9KA6 1.47 Å, Crystal structure of beta-ketoacyl-ACP synthase FabH C112Q in complex with acyl-ACP from…
- 2FAE 1.55 Å, Crystal structure of E. coli decanoyl-ACP
- 6OKC 1.55 Å, Crosslinked Crystal Structure of Type II Fatty Acid Synthase Ketosynthase, FabB, and…
- 6UXE 1.57 Å, Structure of the human mitochondrial desulfurase complex Nfs1-ISCU2(M140I)-ISD11 with…
- 2FAD 1.6 Å, Crystal structure of E. coli heptanoyl-ACP
- 7SQI 1.7 Å, Crosslinked Crystal Structure of Type II Fatty Acid Synthase Ketosynthase, FabB, and…
- 2FAC 1.76 Å, Crystal structure of E. coli hexanoyl-ACP
- 6W1D 1.79 Å, Structure of human mitochondrial complex Nfs1-ISCU2 (WT)-ISD11 with E.coli ACP1 at 1.8 A…
- 6U0J 1.9 Å, Crosslinked Crystal Structure of Malonyl-CoA Acyl Carrier Protein Transacylase, FabD,…
- 6WIH 1.9 Å, N-terminal mutation of ISCU2 (L35H36) traps Nfs1 Cys loop in the active site of ISCU2…
Browse structure collections
About this viewer
MolViewer shows 3EJB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.