3EJE: P450BioI

Crystal Structure of P450BioI in complex with octadec-9Z-enoic acid ligated Acyl Carrier Protein. Determined by X-ray diffraction at 2.1 Å resolution. Released 7 Oct 2008.

Method: X-ray diffraction
Resolution: 2.1 Å
Organisms: Escherichia coli, Bacillus subtilis
Chains: 8
Atoms: 15,827
Mol. weight: 233.71 kDa
Ligands: HEM, HTG, ZMO
Released: 7 Oct 2008

Explore 3EJE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3EJE contains 117 α-helices and 64 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	20-22	3
α-helix	23-35	13
β-strand	47	1	1
α-helix	58-69	12
α-helix	76-81	6
β-strand	84	1	1
α-helix	85-93	9

Chain B: 25 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	10-13	4
α-helix	15-25	11
β-strand	28-33	6	2
β-strand	36-41	6	2
α-helix	44-52	9
β-strand	56-57	2	2
α-helix	70-77	8
α-helix	80-82	3
α-helix	87-95	9
α-helix	96-98	3
α-helix	101-105	5
α-helix	108-120	13
β-strand	127-129	3	3
α-helix	130-135	6
α-helix	136-147	12
α-helix	151-153	3
α-helix	154-164	11
α-helix	165-168	4
α-helix	174-200	27
α-helix	206-211	6
α-helix	221-252	32
α-helix	254-256	3
α-helix	258-262	5
α-helix	264-266	3
α-helix	267-277	11
β-strand	281	1	4
β-strand	283-288	6	2
β-strand	292-294	3	5
β-strand	297-299	3	5
α-helix	300	1
β-strand	304-308	5	2
α-helix	309-312	4
α-helix	340-342	3
α-helix	347-364	18
β-strand	369-370	2	3
β-strand	377	1	6
β-strand	383	1	4
β-strand	386	1	6
β-strand	390-392	3	3

Chain C: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	20-22	3
α-helix	23-35	13
β-strand	47	1	7
α-helix	58-69	12
α-helix	76-81	6
β-strand	84	1	7
α-helix	85-94	10

Chain D: 24 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	7-13	7
α-helix	15-25	11
β-strand	28-33	6	8
β-strand	36-41	6	8
α-helix	44-52	9
β-strand	56-57	2	8
α-helix	70-77	8
α-helix	80-82	3
α-helix	87-95	9
α-helix	96-98	3
α-helix	101-105	5
α-helix	108-120	13
β-strand	127-129	3	9
α-helix	130-135	6
α-helix	136-147	12
α-helix	151-153	3
α-helix	154-164	11
α-helix	165-168	4
α-helix	174-200	27
α-helix	206-212	7
α-helix	221-252	32
α-helix	254-262	9
α-helix	264-266	3
α-helix	267-277	11
β-strand	281	1	10
β-strand	283-288	6	8
β-strand	292-294	3	11
β-strand	297-299	3	11
α-helix	300	1
β-strand	304-308	5	8
α-helix	309-312	4
α-helix	340-342	3
α-helix	347-364	18
β-strand	369-370	2	9
β-strand	377	1	12
β-strand	383	1	10
β-strand	386	1	12
β-strand	390-392	3	9

Chain E: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	20-22	3
α-helix	23-35	13
β-strand	47	1	13
α-helix	58-69	12
α-helix	76-79	4
β-strand	84	1	13
α-helix	85-92	8

Chain F: 24 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	10-13	4
α-helix	15-25	11
β-strand	28-33	6	14
β-strand	36-41	6	14
α-helix	44-52	9
β-strand	56-57	2	14
α-helix	70-77	8
α-helix	80-82	3
α-helix	87-95	9
α-helix	96-98	3
α-helix	101-105	5
α-helix	108-120	13
β-strand	127-129	3	15
α-helix	130-135	6
α-helix	136-147	12
α-helix	151-153	3
α-helix	154-164	11
α-helix	165-168	4
α-helix	174-200	27
α-helix	206-211	6
α-helix	221-252	32
α-helix	254-262	9
α-helix	264-266	3
α-helix	267-277	11
β-strand	281	1	16
β-strand	283-288	6	14
β-strand	292-294	3	17
β-strand	297-299	3	17
α-helix	300	1
β-strand	304-308	5	14
α-helix	309-312	4
α-helix	340-342	3
α-helix	347-364	18
β-strand	369-370	2	15
β-strand	377	1	18
β-strand	383	1	16
β-strand	386	1	18
β-strand	390-392	3	15

Chain G: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	20-22	3
α-helix	23-35	13
β-strand	47	1	19
α-helix	58-69	12
α-helix	76-81	6
β-strand	84	1	19
α-helix	85-91	7

Chain H: 24 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	7-13	7
α-helix	15-25	11
β-strand	28-33	6	20
β-strand	36-41	6	20
α-helix	44-52	9
β-strand	56-57	2	20
α-helix	70-77	8
α-helix	80-82	3
α-helix	87-95	9
α-helix	96-98	3
α-helix	101-105	5
α-helix	108-120	13
β-strand	127-129	3	21
α-helix	130-135	6
α-helix	136-147	12
α-helix	151-153	3
α-helix	154-164	11
α-helix	165-168	4
α-helix	174-200	27
α-helix	206-211	6
α-helix	221-252	32
α-helix	254-262	9
α-helix	264-266	3
α-helix	267-277	11
β-strand	281	1	22
β-strand	283-288	6	20
β-strand	292-294	3	23
β-strand	297-299	3	23
α-helix	300	1
β-strand	304-308	5	20
α-helix	309-312	4
α-helix	340-342	3
α-helix	347-364	18
β-strand	369-370	2	21
β-strand	377	1	24
β-strand	383	1	22
β-strand	386	1	24
β-strand	390-392	3	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Acyl carrier protein	A, C, E, G	protein	97	Escherichia coli	P0A6A8 (AlphaFold model)
Biotin biosynthesis cytochrome P450-like enzyme	B, D, F, H	protein	404	Bacillus subtilis	P53554 (AlphaFold model)

Sequence of entity 1 (A, C, E, G), FASTA

>3EJE_1 Acyl carrier protein (chains A, C, E, G)
GSSHHHHHHSSGLVPRGSHMSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTV
ELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA

Sequence of entity 2 (B, D, F, H), FASTA

>3EJE_2 Biotin biosynthesis cytochrome P450-like enzyme (chains B, D, F, H)
TIASSTASSEFLKNPYSFYDTLRAVHPIYKGSFLKYPGWYVTGYEETAAILKDARFKVRT
PLPESSTKYQDLSHVQNQMMLFQNQPDHRRLRTLASGAFTPRTTESYQPYIIETVHHLLD
QVQGKKKMEVISDFAFPLASFVIANIIGVPEEDREQLKEWAASLIQTIDFTRSRKALTEG
NIMAVQAMAYFKELIQKRKRHPQQDMISMLLKGREKDKLTEEEAASTCILLAIAGHETTV
NLISNSVLCLLQHPEQLLKLRENPDLIGTAVEECLRYESPTQMTARVASEDIDICGVTIR
QGEQVYLLLGAANRDPSIFTNPDVFDITRSPNPHLSFGHGHHVCLGSSLARLEAQIAINT
LLQRMPSLNLADFEWRYRPLFGFRALEELPVTFEASWSHPQFEK

Ligands and cofactors

ID	Name	Formula	Copies
HEM	Protoporphyrin IX containing FE	C34 H32 Fe N4 O4	4
HTG	heptyl 1-thio-beta-D-glucopyranoside	C13 H26 O5 S	7
ZMO	S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}ami…	C29 H55 N2 O8 P S	4

Primary citation

Structural insights from a P450 Carrier Protein complex reveal how specificity is achieved in the P450(BioI) ACP complex. Cryle, M.J., Schlichting, I. Proc Natl Acad Sci U S A (2008) 105:15696-15701. DOI 10.1073/pnas.0805983105 · PubMed

Other PDB entries of the same protein (UniProt P0A6A8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1T8K 1.1 Å, Crystal Structure of apo acyl carrier protein from E. coli
1L0I 1.2 Å, Crystal structure of butyryl-ACP I62M mutant
9KA6 1.47 Å, Crystal structure of beta-ketoacyl-ACP synthase FabH C112Q in complex with acyl-ACP from…
2FAE 1.55 Å, Crystal structure of E. coli decanoyl-ACP
6OKC 1.55 Å, Crosslinked Crystal Structure of Type II Fatty Acid Synthase Ketosynthase, FabB, and…
6UXE 1.57 Å, Structure of the human mitochondrial desulfurase complex Nfs1-ISCU2(M140I)-ISD11 with…
2FAD 1.6 Å, Crystal structure of E. coli heptanoyl-ACP
7SQI 1.7 Å, Crosslinked Crystal Structure of Type II Fatty Acid Synthase Ketosynthase, FabB, and…
2FAC 1.76 Å, Crystal structure of E. coli hexanoyl-ACP
6W1D 1.79 Å, Structure of human mitochondrial complex Nfs1-ISCU2 (WT)-ISD11 with E.coli ACP1 at 1.8 A…
6U0J 1.9 Å, Crosslinked Crystal Structure of Malonyl-CoA Acyl Carrier Protein Transacylase, FabD,…
6WIH 1.9 Å, N-terminal mutation of ISCU2 (L35H36) traps Nfs1 Cys loop in the active site of ISCU2…

Browse structure collections

About this viewer

MolViewer shows 3EJE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.