X-ray structure of the human mitogen-activated protein kinase kinase 1 (MEK1) in a ternary complex with U0126, ADP and MG2P. Determined by X-ray diffraction at 2.0 Å resolution. Released 24 Feb 2009.
Explore 3EQH in 3D Show helices and sheets RCSB PDB PDBe
3EQH contains 18 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 44-58 | 15 | |
| α-helix | 65-67 | 3 | |
| β-strand | 68-76 | 9 | 1 |
| β-strand | 81-87 | 7 | 1 |
| β-strand | 92-99 | 8 | 1 |
| α-helix | 105-115 | 11 | |
| α-helix | 116-120 | 5 | |
| β-strand | 126 | 1 | 2 |
| β-strand | 129-134 | 6 | 1 |
| β-strand | 139-143 | 5 | 1 |
| β-strand | 150 | 1 | 2 |
| α-helix | 151-158 | 8 | |
| α-helix | 163-184 | 22 | |
| α-helix | 193-195 | 3 | |
| β-strand | 196-198 | 3 | 2 |
| β-strand | 204-206 | 3 | 2 |
| α-helix | 213-219 | 7 | |
| α-helix | 232-236 | 5 | |
| α-helix | 242-258 | 17 | |
| α-helix | 268-275 | 8 | |
| α-helix | 310-319 | 10 | |
| α-helix | 321-323 | 3 | |
| α-helix | 325-326 | 2 | |
| α-helix | 332-341 | 10 | |
| α-helix | 352-356 | 5 | |
| α-helix | 359-366 | 8 | |
| α-helix | 371-379 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Dual specificity mitogen-activated protein kinase kinase 1 | A | protein | 360 | Homo sapiens | Q02750 (AlphaFold model) |
>3EQH_1 Dual specificity mitogen-activated protein kinase kinase 1 (chains A) GKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLV MARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQ VLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSG QLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELEL MFGCQVEGDAAETPPRPRTPGRPLNKFGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLE FQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQPSTPTHAAGV
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 1 |
| MG | Magnesium ion | Mg | 1 |
| ADP | Adenosine-5'-diphosphate | C10 H15 N5 O10 P2 | 1 |
| 5BM | (2Z)-bis{amino[(2-aminophenyl)sulfanyl]methylidene}butanedinitrile | C18 H16 N6 S2 | 1 |
Water and common crystallization additives (NA) are not listed.
Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors. Fischmann, T.O., Smith, C.K., Mayhood, T.W. et al. Biochemistry (2009) 48:2661-2674. DOI 10.1021/bi801898e · PubMed
Other PDB entries of the same protein (UniProt Q02750 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3EQH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.