3EQY: Human MDMX

Crystal structure of human MDMX in complex with a 12-mer peptide inhibitor. Determined by X-ray diffraction at 1.63 Å resolution. Released 17 Mar 2009.

Method: X-ray diffraction
Resolution: 1.63 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,910
Mol. weight: 22.5 kDa
Ligands: PO4, GAI
Released: 17 Mar 2009

Explore 3EQY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3EQY contains 10 α-helices and 14 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	27	1	1
β-strand	28-29	2	2
α-helix	31-39	9
β-strand	47	1	1
α-helix	49-62	14
β-strand	66-67	2	3
β-strand	70-75	6	3
α-helix	80-85	6
β-strand	89-91	3	3
α-helix	96-105	10
β-strand	106-107	2	2

Chains C and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	3-8	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mdm4 protein	A, B	protein	85	Homo sapiens	O15151 (AlphaFold model)
12-mer peptide inhibitor	C, D	protein	12

Sequence of entity 1 (A, B), FASTA

>3EQY_1 Mdm4 protein (chains A, B)
INQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDAAAQHMVYCGGDLLGE
LLGRQSFSVKDPSPLYDMLRKNLVT

Sequence of entity 2 (C, D), FASTA

>3EQY_2 12-mer peptide inhibitor (chains C, D)
TSFAEYWNLLSP

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	4
GAI	Guanidine	C H5 N3	2

Primary citation

Structural basis for high-affinity peptide inhibition of p53 interactions with MDM2 and MDMX. Pazgier, M., Liu, M., Zou, G. et al. Proc Natl Acad Sci U S A (2009) 106:4665-4670. DOI 10.1073/pnas.0900947106 · PubMed

Other PDB entries of the same protein (UniProt O15151 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6Q9Y 1.2 Å, HDMX (14-111; C17S) COMPLEXED WITH COMPOUND 16 AT 1.20A; Structural states of Hdm2 and…
3FEA 1.33 Å, Crystal Structure of HdmX bound to the p53-peptidomimetic…
3FE7 1.35 Å, Crystal Structure of HdmX bound to the p53-peptidomimetic…
3FDO 1.4 Å, Structure of human MDMX in complex with high affinity peptide
3LBJ 1.5 Å, Structure of human MDMX protein in complex with a small molecule inhibitor
4RXZ 1.55 Å, Crystal Structure of MDMX phosporylated Tyr99 in complex with a 12-mer peptide
6Q9W 1.55 Å, X-ray structure of compound 15 bound to HdmX: Structural states of Hdm2 and HdmX: X-ray…
7C3Y 1.63 Å, Crystal structure of the N-terminal domain of human MdmX protein in complex with Nutlin3a
7C44 1.65 Å, Crystal structure of the p53-binding domain of human MdmX protein in complex with Nutlin3a
8HDG 1.73 Å, Small peptide enhances the binding of nutline-3a to MdmX
3JZP 1.74 Å, Human MDMX liganded with a 12mer peptide inhibitor (pDI6W)
3JZO 1.8 Å, Human MDMX liganded with a 12mer peptide (pDI)

Browse structure collections

About this viewer

MolViewer shows 3EQY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.