Crystal Structure of Synaptotagmin I C2A domain with Mn(II). Determined by X-ray diffraction at 1.4 Å resolution. Released 6 Oct 2009.
Explore 3F05 in 3D Show helices and sheets RCSB PDB PDBe
3F05 contains 10 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 10-15 | 6 | |
| α-helix | 17-140 | 2 | |
| β-strand | 144-152 | 9 | 1 |
| β-strand | 157-166 | 10 | 1 |
| α-helix | 168-170 | 3 | |
| β-strand | 179-186 | 8 | 2 |
| α-helix | 191-192 | 2 | |
| β-strand | 193-194 | 2 | 2 |
| α-helix | 195-197 | 3 | |
| β-strand | 205-212 | 8 | 1 |
| α-helix | 216-219 | 4 | |
| β-strand | 223-230 | 8 | 2 |
| α-helix | 236-237 | 2 | |
| β-strand | 238-246 | 9 | 2 |
| α-helix | 247-249 | 3 | |
| β-strand | 256-261 | 6 | 1 |
| α-helix | 262 | 1 | |
| β-strand | 263 | 1 | 2 |
| α-helix | 264 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Synaptotagmin-1 | A | protein | 143 | Homo sapiens | P21579 (AlphaFold model) |
>3F05_1 Synaptotagmin-1 (chains A) GSPGIGGGGGGILDSMVEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVK VFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGE FKVPMNTVDFGHVTEEWRDLQSA
| ID | Name | Formula | Copies |
|---|---|---|---|
| MN | Manganese (II) ion | Mn | 1 |
Water and common crystallization additives (SO4) are not listed.
Cystal structure of synaptotagmin I C2A. Guo, F., Dakshinamurthy, R., Thallapuranam, S.K.K. et al. To be published.
Other PDB entries of the same protein (UniProt P21579 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3F05 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.