Crystal structure of human chromobox homolog 1 (CBX1). Determined by X-ray diffraction at 1.8 Å resolution. Released 25 Nov 2008.
Explore 3F2U in 3D Show helices and sheets RCSB PDB PDBe
3F2U contains 3 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-14 | 10 | 1 |
| β-strand | 17-24 | 8 | 1 |
| α-helix | 29-31 | 3 | |
| β-strand | 33-36 | 4 | 1 |
| α-helix | 37-39 | 3 | |
| α-helix | 43-50 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Chromobox protein homolog 1 | A | protein | 55 | Homo sapiens | P83916 (AlphaFold model) |
>3F2U_1 Chromobox protein homolog 1 (chains A) GEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKT
Crystal structure of the complex of human chromobox homolog 1 (CBX1). Ravichandran, M., Amaya, M.F., Tempel, W. et al. To be published.
Other PDB entries of the same protein (UniProt P83916 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3F2U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.