3Q6S: Chromobox protein homolog 1

The crystal structure of the heterochromatin protein 1 beta chromoshadow domain complexed with a peptide from Shugoshin 1. Determined by X-ray diffraction at 1.93 Å resolution. Released 14 Dec 2011.

Method: X-ray diffraction
Resolution: 1.93 Å
Organism: Homo sapiens
Chains: 6
Atoms: 2,534
Mol. weight: 40.24 kDa
Released: 14 Dec 2011

Explore 3Q6S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3Q6S contains 17 α-helices and 20 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	112-115	4
β-strand	119-126	8	1
β-strand	133-138	6	1
β-strand	144-148	5	1
α-helix	149-155	7
α-helix	157-165	9
β-strand	168-171	4	2

Chain B: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	112-115	4
α-helix	117-118	2
β-strand	119-126	8	3
β-strand	133-138	6	3
β-strand	145-148	4	3
α-helix	149-155	7
α-helix	157-165	9
β-strand	168-173	6	4

Chain C: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	112-115	4
α-helix	117-118	2
β-strand	119-128	10	5
β-strand	131-138	8	5
β-strand	145-148	4	5
α-helix	149-155	7
α-helix	157-165	9
β-strand	168-170	3	4

Chain D: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	112-115	4
α-helix	117-118	2
β-strand	119-126	8	6
β-strand	133-138	6	6
β-strand	145-148	4	6
α-helix	149-155	7
α-helix	157-167	11
β-strand	168-173	6	2

Chain E: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	448-455	8	4
α-helix	456	1
β-strand	457	1	3
α-helix	458	1

Chain F: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	448-456	9	2
β-strand	457	1	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chromobox protein homolog 1	A, B, C, D	protein	78	Homo sapiens	P83916 (AlphaFold model)
Shugoshin-like 1	E, F	protein	19		Q5FBB7 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3Q6S_1 Chromobox protein homolog 1 (chains A, B, C, D)
EKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEER
LTWHSYPSEDDDKKDDKN

Sequence of entity 2 (E, F), FASTA

>3Q6S_2 Shugoshin-like 1 (chains E, F)
TNVSLYPVVKIRRLSLSPK

Primary citation

Mitotic centromeric targeting of HP1 and its binding to Sgo1 are dispensable for sister-chromatid cohesion in human cells. Kang, J., Chaudhary, J., Dong, H. et al. Mol Biol Cell (2011) 22:1181-1190. DOI 10.1091/mbc.E11-01-0009 · PubMed

Other PDB entries of the same protein (UniProt P83916 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2FMM 1.8 Å, Crystal Structure of EMSY-HP1 complex
3F2U 1.8 Å, Crystal structure of human chromobox homolog 1 (CBX1)
5T1G 1.9 Å, chromo shadow domain of CBX1 in complex with a histone peptide
6D07 2.1 Å, Crystal structure of the complex between human chromobox homolog 1 (CBX1) and H3K9me3…
6D08 2.1 Å, Crystal structure of an engineered bump-hole complex of mutant human chromobox homolog 1…

Browse structure collections

About this viewer

MolViewer shows 3Q6S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.