5T1G: Chromo shadow domain of CBX1

chromo shadow domain of CBX1 in complex with a histone peptide. Determined by X-ray diffraction at 1.9 Å resolution. Released 14 Sept 2016.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 533
Mol. weight: 10.9 kDa
Released: 14 Sept 2016

Explore 5T1G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5T1G contains 3 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	112-115	4
β-strand	119-126	8	1
β-strand	133-138	6	1
β-strand	145-148	4	1
α-helix	149-155	7
α-helix	157-166	10

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	47-48	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chromobox protein homolog 1	A	protein	79	Homo sapiens	P83916 (AlphaFold model)
Histone H3.1	B	protein	15	Homo sapiens	P68431 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5T1G_1 Chromobox protein homolog 1 (chains A)
GEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEE
RLTWHSYPSEDDDKKDDKN

Sequence of entity 2 (B), FASTA

>5T1G_2 Histone H3.1 (chains B)
PHRYRPGTVALREIR

Primary citation

chromo shadow domain of CBX1 in complex with a histone peptide. Liu, Y., Tempel, W., Bountra, C. et al. To be published.

Other PDB entries of the same protein (UniProt P83916 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2FMM 1.8 Å, Crystal Structure of EMSY-HP1 complex
3F2U 1.8 Å, Crystal structure of human chromobox homolog 1 (CBX1)
3Q6S 1.93 Å, The crystal structure of the heterochromatin protein 1 beta chromoshadow domain…
6D07 2.1 Å, Crystal structure of the complex between human chromobox homolog 1 (CBX1) and H3K9me3…
6D08 2.1 Å, Crystal structure of an engineered bump-hole complex of mutant human chromobox homolog 1…

Browse structure collections

About this viewer

MolViewer shows 5T1G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.